KEGG   Ruegeria pomeroyi: SPO1059Help
Entry
SPO1059           CDS       T00215                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
sil  Ruegeria pomeroyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RIO1 Kdo Kinase-like L_protein_N Haspin_kinase Pox_ser-thr_kin DUF4366
Motif
Other DBs
NCBI-ProteinID: AAV94359
UniProt: Q5LUJ5
Position
1110767..1112878
Genome map
AA seq 703 aa AA seqDB search
MALNTLVDTSIEADQQDDLQPGTTLLHGQYTITCFLNNGGFGITYLAKDSLDRTVVIKEC
FADAFCRRTKTLVSARSRAHQGELKSIIRHFIREAQSLSKLKHPNIVGVHQVFEDNDTAY
MAIDFVDGRDLQDILDDPNATLTPEQIVNMTRKLLSAIGYVHKENLLHRDISPDNILLTK
DGEPVLIDFGAAREETSADGRKHSALRVVKDGYSPQEFYIAGSDQGPWSDLYALAASLYH
VIRGEAPVNGQARLVAIAEQRPDPYAPLAGDVKGYPEGFLEAIDKAMNTKPSTRLQSAED
WLAMLDGNQTAPVAPEAVNNNTAPATEQKQRSRLPAVSLLAVVAGLGVAGFVFYGNNKAE
KGAELAAPVAAQPVKSAQTEPVAGGSSEAPTAAKPTSEIAVAIAPPPEPAAKDAPVAEVT
SQAAAPEIAAVPAETAVVAEPAQTAAPAADTAAPAATESAAADAPGVDAEQAAADSDKII
AAAAAPTETAPAVEAPEVKAAPAPGHEVTYALWDVSIPFEYEEKIVRKAQVVSITGIGTE
TDLAKTGAWIAPGVEIITVNNRPLSTDSRFATQLLNAMQIDPDGYTRVSIRYKDAENKRF
EMGLLAVPVLRRTGMTGGLQFEAGMQDGAWVTVVSQVAAEGAAQFQVSDILLRETTTGSR
LTTADGLSEIMQSLKERDAATASFDILRDGQPASVELKLAGHD
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcactcaatacgcttgtagatacttcaattgaggcggatcaacaggacgatctgcag
ccaggcacaacgttgcttcatggccaatataccatcacgtgctttctgaacaatggcgga
tttggcatcacctatctggccaaggacagtctcgaccggacggtggttatcaaggaatgt
ttcgcggatgcattctgccgccggaccaagacattggtcagcgcccggtcgcgtgcacat
cagggcgagctgaagtcgattatccgccacttcatccgcgaggcgcagagcctgtccaag
ctcaagcatcccaacattgtcggtgtgcatcaggtgttcgaggacaacgataccgcctac
atggcgattgattttgtcgatggccgcgacctgcaggacattctggatgatccgaacgcg
accctgacacctgaacagattgtcaacatgacccgtaagctgttgtcagcaataggttat
gtgcacaaggaaaacctgctgcatcgcgatatttccccggacaacatcctgctgaccaag
gacggcgagccggttctgatcgactttggcgccgcccgcgaggaaaccagcgccgatggc
cgcaagcactctgcgttgcgggtggtcaaggacggctattcgccccaggaattctacatc
gccggcagtgatcaggggccctggagcgatctttatgcgctcgcggcctcgctttatcac
gttatccgtggcgaggcgccggtgaacggtcaggcccgtctggtcgccatcgcggaacag
cgccccgatccctatgccccccttgcaggcgatgtgaagggatatcccgaaggtttcctg
gaagccatcgacaaggcgatgaacaccaaaccctcgacccgcctgcaatccgccgaggac
tggctggccatgctggacggcaaccagaccgcgccggttgcgccggaagctgtaaataac
aacacggctccggccacggaacagaagcagcgcagccgtcttcccgccgtttctctgctt
gcggtcgtggctggtctgggcgtggctggtttcgtcttttatggcaataataaggcggaa
aaaggggccgaactggccgctcccgtagcggcgcaaccggtaaaatccgcgcagaccgaa
ccggtggcaggcgggtcgtccgaggcgccgaccgcagccaagccgacaagcgagatcgca
gtcgccattgcgccgccgccggaaccggccgccaaggatgcccctgtcgcagaggtgacc
agccaagcggctgcgcccgagattgccgccgttcctgccgaaactgcggtggtcgccgaa
ccggcgcagacagcggcacccgccgcggacacggcagcacccgctgccactgaaagcgcg
gccgcagatgcgcccggcgtggatgccgaacaggcggctgccgacagcgacaagatcatc
gcggccgcagccgcgccaaccgaaaccgcgcctgccgtcgaagcacccgaggtgaaggcc
gcaccggctcccggtcacgaggtcacctatgccctgtgggatgtctcgatccccttcgag
tacgaagagaagatcgtgcgcaaggcccaggtggtctcgatcaccggtatcggaaccgag
acggatcttgccaagacaggcgcctggatcgcgccgggggtggagatcatcacggtcaac
aaccgccccctgtcgacggactcgcggtttgcgacacaattgctgaacgccatgcagatc
gatcccgacggctatacccgggtctccatccgctacaaggacgcggaaaacaaacggttt
gaaatgggattgctggccgtgccggttctgcgccggaccggtatgaccggcggcctgcag
ttcgaggcggggatgcaggatggcgcatgggtcaccgttgtcagccaggtcgcggcagaa
ggggcagcccagtttcaggtcagcgatatcctgttgcgcgaaaccacgaccggttcccgc
ctgaccacagctgatgggctgagcgagatcatgcaatcgctgaaggagcgcgatgccgca
accgccagtttcgacattctgcgcgacgggcagccggcctcggtcgagctgaaactcgcc
gggcacgactga

DBGET integrated database retrieval system