KEGG   Ruegeria pomeroyi: SPO1352Help
Entry
SPO1352           CDS       T00215                                 

Definition
(GenBank) hypothetical protein
  KO
K09007  GTP cyclohydrolase IB [EC:3.5.4.16]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00790  Folate biosynthesis
sil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sil00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPO1352
Enzymes [BR:sil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SPO1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCHY-1
Motif
Other DBs
NCBI-ProteinID: AAV94640
UniProt: Q5LTR1
Position
1411588..1412691
Genome map
AA seq 367 aa AA seqDB search
MNLHPRDIDETPDRDAAAAALAVLRRWASGATSTEISELDPSVARLLPDAALSNYPDLSR
QYPEDFTVDATYRAGLPDLQNGPSSLIRGAKQQIQHVGISNFRLPIRFHRKEGDDLTLET
SVTGTVSLEAGKKGINMSRIMRSFYKHAERTFSFEVIEAALDDYMTDLDSFDARIQMRFS
YPERIESLRSGLSGYQYYDIALELVEQGGERLKIMHLDYVYSSTCPCSLELSEHARSSRG
QLATPHSQRSVARLSVVVDGDASCLWFEDLIALCRRAVPTETQVMVKREDEQAFAELNAA
NPIFVEDAARLFCAELLADHRIGDFRVVASHQESLHSHDAVSVLTEGATFATASLDPRLF
ATLFHVG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacacccccgcgatatcgacgagacacccgaccgcgacgcagccgccgccgcg
cttgcggtgttgcgccgctgggcctcgggtgccaccagcaccgagatcagcgagcttgac
ccctcggtcgcacggctgctgccggatgcggccctgtcgaactatcccgatctcagccgg
cagtacccagaggatttcaccgtcgatgcaacctatcgcgccgggctgcctgacctgcag
aacggcccgtccagcctgatccgcggggcaaagcagcagatccagcatgtgggcatctcg
aatttccgcctgccgatccgctttcaccgcaaggagggcgacgacctgacgctggaaacc
tcggtgaccggcaccgtcagcctggaggcgggcaagaagggcatcaacatgtcccgcatc
atgcggtccttctacaaacatgccgagcgcacgttcagctttgaggtgatcgaggccgcg
ctggacgattacatgaccgatctggacagtttcgacgcgcgtatccagatgcggttctcc
tatcccgagcggatcgaaagcctgcgttcggggctgagcggctatcagtactacgatatc
gcgctggaactggtcgaacagggcggcgagcggctcaagatcatgcatctggactatgtc
tattcctcgacctgcccctgttcgctggaactcagcgaacatgcgcgctccagccggggg
cagctggccacgccgcattcgcagcgctcggtcgcgcggctgtcggtggtggtggatggc
gatgccagctgtctgtggttcgaggatctgatcgcgctgtgccgccgggcggtgccgacc
gagacgcaggtgatggtcaagcgcgaggacgagcaggcattcgccgagctgaacgccgcc
aacccgatctttgtcgaggacgcggcgcggctgttctgcgccgagctgctggccgaccac
cggatcggcgatttccgggtggtcgcgagccaccaggaaagcctgcacagccatgatgcg
gtctcggtcctgaccgagggggcgacctttgccaccgccagtctcgatccgcgcctcttc
gccacgctgttccacgtcggatag

DBGET integrated database retrieval system