KEGG   Ruegeria pomeroyi: SPO1509Help
Entry
SPO1509           CDS       T00215                                 

Definition
(GenBank) cytochrome c family protein
  KO
K08738  cytochrome c
Organism
sil  Ruegeria pomeroyi
Pathway
sil02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sil00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SPO1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AAV94796
UniProt: Q5LTA5
Position
complement(1585980..1586387)
Genome map
AA seq 135 aa AA seqDB search
MRPVSYALALMMAASPALADTKFEQIKIEAGAALYDGECRRCHASDTDHESYGPPLENVL
GRGAGTYPDYDYSIALEASGIVWTPAALRAWMEDNTGFMPGTKMRHVGIEDRTVQDFILA
YLASLSTRDPKQISD
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgtttcctatgcgctggcgctgatgatggcggcctcgcctgcgcttgccgac
accaagttcgagcagatcaagatcgaggcgggcgcggcgctctatgatggcgaatgtcgg
cgctgccatgcctcggacactgatcacgagagctatggcccaccgctggagaacgtgctg
ggacgtggggccggcacctatcccgattacgactattccattgcgctcgaggcctcgggc
atcgtctggacgcctgcggcgctgcgcgcatggatggaggacaataccggcttcatgccc
ggtaccaagatgcgccatgtcgggatcgaggaccggacagtgcaggatttcattctggcc
tatctggccagcctcagcacccgcgaccccaagcagatttccgactga

DBGET integrated database retrieval system