KEGG   Ruegeria pomeroyi: SPO1793Help
Entry
SPO1793           CDS       T00215                                 

Definition
(GenBank) WD domain/cytochrome c family protein
  KO
K08738  cytochrome c
Organism
sil  Ruegeria pomeroyi
Pathway
sil02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sil00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SPO1793
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    SPO1793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 Cytochrom_C ANAPC4_WD40 Cytochrome_CBB3 Nbas_N Ge1_WD40 Nup160
Motif
Other DBs
NCBI-ProteinID: AAV95072
UniProt: Q5LSH5
Position
complement(1908913..1910262)
Genome map
AA seq 449 aa AA seqDB search
MGARAPFAVAGRGEIGRGQQGQAQPGGMMRALALALLLWPACAAAEFFTLKGHGGPVMGI
AVGPEGQIATASFDNSVGLWTGRAPHWFEGHEAAVNTVAFQGGVLYSAGDDFTLRRWPEG
TILGRHKGKITGLALSETLAATASWDGTIGLWPLDSRAPRSLDAASGVNAVAFSPDGTLL
YSAGMDGVLRLWDVASGSELRQITRHGFGINEIVLNDADGWLAYGAVDGVTRILDLATGA
ERDFTLDRRPVLALALSPDRSQLAVGDGEGYIMVIDTASWRIARDFRATLRGPVWALAFS
PDGANIHAGGIDDTMYSWPVASLSEHGKMASGERSFLKDPDQMDNGERQFARKCSICHAL
TPEGGRRAGPTLYRVFGRRAGTLPGYLYSDTLAGSDIVWTEESINSLFDLGPDHYIPGSK
MPMQRITGAQDRADLIAYLRRATLAKESP
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgcgagcaccattcgctgtggctggacgaggtgaaatcggccgaggccagcaa
ggccaggcccagcccggcggaatgatgcgcgcgctggcgctggcgctgctgctctggccc
gcctgcgcggcggcagagttcttcaccctcaaggggcacggcgggccggtgatgggcatt
gccgtcggcccggaggggcagatcgccaccgccagtttcgacaattccgtggggctgtgg
accgggcgggcgccgcattggttcgaagggcacgaggccgccgtcaatacggtggcgttt
cagggtggcgtgctctactcggcaggcgacgatttcaccctgcgccgctggcccgaaggc
accatcctgggccgccacaagggcaagatcaccggtcttgccctgtcggagaccctcgcc
gccaccgccagctgggacggaaccatcggcctctggccgctggacagcagggcaccgcgc
agccttgatgccgccagcggggtcaacgcggtcgccttttctcccgatggtacgctgctt
tactctgccggcatggatggcgtgctgcggctatgggatgtcgcgagcggcagcgaattg
cgccagatcacccggcacgggttcggcatcaacgagatcgtactgaatgacgcagacggc
tggctggcctatggcgcggtcgatggggtgacgcggattctcgaccttgccaccggggcc
gagcgcgactttaccctcgaccgtcgcccggttctggcgctggcgctcagccccgatcgc
agccagctcgcggtgggcgatggcgaaggctatatcatggtgatcgacaccgccagctgg
cgcatcgcccgcgacttccgcgccaccctgcgcgggccggtctgggcgctggccttttcg
ccggatggcgcgaatatccatgcaggcggcatcgacgacaccatgtacagctggccggtg
gcctcactctcggaacatggcaagatggcgagcggcgagcgcagctttctgaaggacccc
gaccagatggacaatggcgagcgccagtttgcccgcaaatgctcgatctgccacgcgctg
acgcccgagggcgggcggcgcgccgggccgacgctgtaccgggtctttggccgccgcgcc
ggcaccctgcccggctatctctattccgacacgctggcgggttcggatatcgtctggacc
gaggagagcatcaattcgcttttcgatctgggcccggaccattacattccggggtcaaag
atgcccatgcaacggatcaccggcgcccaggaccgcgccgacctgatcgcctatctgcgc
cgggccaccctggcaaaggagtccccatga

DBGET integrated database retrieval system