KEGG   Ruegeria pomeroyi: SPO2076Help
Entry
SPO2076           CDS       T00215                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00860  Porphyrin and chlorophyll metabolism
sil01100  Metabolic pathways
sil01110  Biosynthesis of secondary metabolites
sil01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPO2076 (hemB)
Enzymes [BR:sil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SPO2076 (hemB)
Exosome [BR:sil04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPO2076 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Pantoate_transf AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AAV95347
UniProt: Q5LRP9
Position
2210592..2211590
Genome map
AA seq 332 aa AA seqDB search
MTPTVAAFPAARFRRARKSPALRALVRENSLGVDDLIWPVFVRDGEGIEEPVPSMPGVMR
RSVDRIAQAAVEAQALGIPAICLFPYTDAALKTEDCAEAWSPDNLSNRAIRAIKAAAPDI
AVMTDVALDPYNINGHDGYVVDGEIVNDETVEALVKMTLAQAEAGADIIGPSDMMDGRIG
AMRQALEAAGHRNVLILSYAAKYASAFYGPFRDAVGASGALTGDKKTYQMDPGNSDEALR
LIQRDLSEGADMVMIKPGLAYLDICHRVKQSFGAPTYAYQVSGEYAMIKAAAQNGWIDGD
KVMLESLLAFKRAGCDGILTYFAPDVARILQG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgaccgtcgccgcctttcccgccgcccgtttccggcgcgcgcgcaaatcgccc
gcgctgcgtgcgctggtgcgcgagaattccctgggcgtcgatgatctgatctggccggtc
ttcgtgcgcgatggcgaggggatagaagaaccggtgccctcgatgcccggggtgatgcgc
cgttctgtcgacaggatcgcccaggccgcggtcgaggcgcaggcgctgggcattcctgcg
atctgcctgtttccctataccgatgccgcgctgaaaaccgaggattgcgccgaggcctgg
agccccgacaacctgtccaaccgcgccatccgtgcgatcaaggccgccgcccccgacatc
gcggtgatgaccgatgtggcgctcgatccctataacatcaacggccatgacggctatgtg
gtggacggcgagatcgtcaatgacgaaaccgtcgaggcgctggtcaagatgacgctggcg
caggccgaagcgggcgccgatatcatcggcccctccgacatgatggacgggcgcatcggc
gccatgcgccaggcgctcgaggcggccgggcatcgcaacgtgctgatcctcagctatgcg
gccaaatatgccagcgccttttacgggccgttccgcgacgcggtcggtgcctcgggcgcg
ctgaccggcgacaagaagacctatcagatggacccgggcaacagcgacgaggcgctgcgc
ctgatccaacgcgacctgtccgagggcgccgacatggtgatgatcaaaccggggctggcc
tatctggacatctgccaccgggtcaaacagagctttggcgcgcccacctatgcctatcag
gtctcgggcgaatacgcgatgatcaaggcggcggcgcagaatggctggatcgacggcgac
aaggtgatgctggaaagcctgctggccttcaagcgcgccggttgcgacggcatcctgacc
tatttcgcccccgacgtggcccgcatcctgcaagggtag

DBGET integrated database retrieval system