KEGG   Ruegeria pomeroyi: SPO2920Help
Entry
SPO2920           CDS       T00215                                 

Gene name
fabJ-1
Definition
(GenBank) fatty oxidation complex, alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00071  Fatty acid degradation
sil00280  Valine, leucine and isoleucine degradation
sil00281  Geraniol degradation
sil00310  Lysine degradation
sil00362  Benzoate degradation
sil00380  Tryptophan metabolism
sil00410  beta-Alanine metabolism
sil00640  Propanoate metabolism
sil00650  Butanoate metabolism
sil00903  Limonene and pinene degradation
sil00930  Caprolactam degradation
sil01040  Biosynthesis of unsaturated fatty acids
sil01100  Metabolic pathways
sil01110  Biosynthesis of secondary metabolites
sil01120  Microbial metabolism in diverse environments
sil01130  Biosynthesis of antibiotics
sil01200  Carbon metabolism
sil01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SPO2920 (fabJ-1)
   00650 Butanoate metabolism
    SPO2920 (fabJ-1)
  Lipid metabolism
   00071 Fatty acid degradation
    SPO2920 (fabJ-1)
   01040 Biosynthesis of unsaturated fatty acids
    SPO2920 (fabJ-1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPO2920 (fabJ-1)
   00310 Lysine degradation
    SPO2920 (fabJ-1)
   00380 Tryptophan metabolism
    SPO2920 (fabJ-1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPO2920 (fabJ-1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SPO2920 (fabJ-1)
   00281 Geraniol degradation
    SPO2920 (fabJ-1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPO2920 (fabJ-1)
   00930 Caprolactam degradation
    SPO2920 (fabJ-1)
Enzymes [BR:sil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SPO2920 (fabJ-1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SPO2920 (fabJ-1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SPO2920 (fabJ-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 F420_oxidored 2-Hacid_dh_C DAO UDPG_MGDP_dh_N Pyr_redox_2 NAD_Gly3P_dh_N NAD_binding_8 Sacchrp_dh_NADP FAD_binding_3 ApbA
Motif
Other DBs
NCBI-ProteinID: AAV96161
UniProt: Q5LPC8
Position
3117718..3119919
Genome map
AA seq 733 aa AA seqDB search
MSDFTLTKDADGVAFITWDAQGKSMNVMTREAFELVDSLVDQALADDEVKGIVITSGKSD
FAGGMDLNTLAVIREEAGENPAQGLFDFVMGGHRIMRKLELAGMDPKTKKGGKPVACAIN
GTCAGIGTEIALACHHRVMTTNPKAKIGLPEILLGIFPGGGGTIRYSRMVGAMAAAPVLL
EGKMMDPAKAKGAQMVDALADDPVAAAKEWVLNAKDADLVKPWDAKGYKMPGGAPYHPAG
FMTFVGASAMVNGKTQGAFPAPKALLSAIYEGALVDFDTALRIEARWFTHVLMNPSSSAM
IRSLFINKQALEKGAVRPKDIPDQRVKKLGVLGAGMMGAGIALVSAQAGMEVVLIDRDQA
AADKGKAYTEAYLDKGMKRGKVTAEKKEAMLGLITATPDLDALKGCDLIIEAVFEDPGVK
AEMTKKVEAIIPEDCIFASNTSTLPITGLAKASVRPEQFIGIHFFSPVEKMLLVEIIKGK
ETGPRAVAKALDYVRQIRKTPIVVNDARFFYCNRCIIPYVNEGARMITEGVSPVLIDNAA
RQLGFPVGPIQLTDETSIDLGAKIARATKAAMGNAYPESPADDLIFWMEELGRMGRKANA
GFFDYDDKGKRTGYWQGLQDKYPLAEEQPDLIEVQERLMFAQVLEAVRALEEGVLEDIRE
GDVGAILAWGFAPWSGGPLSWIDIIGTPYAADRCDQLAAKYGERFACPPLLREMADKGQS
FYGRFDPEAKSAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattttacgctgaccaaggacgccgacggcgtcgccttcatcacctgggatgct
cagggcaagtcgatgaacgtgatgacccgcgaggcctttgaactggttgacagcctggtc
gatcaggcgctggccgatgacgaggtcaagggcatcgtcatcaccagcggcaagagcgat
ttcgccggcggcatggacctgaacacgctggccgtgatccgcgaggaagcgggcgaaaac
ccggcccagggcctgttcgacttcgtcatgggcggccaccgcatcatgcgcaagctggaa
ctggcgggcatggaccccaagaccaagaagggcggcaagccggtggcctgcgccatcaac
ggcacctgcgccgggatcggcaccgagatcgcgctggcctgtcatcaccgggtgatgacc
accaaccccaaggccaagatcggcctgcccgagatcctgctgggcatcttccccggcggc
ggcggcaccatccgctattcccgcatggtgggcgccatggccgcggccccggtgctgctg
gaaggcaagatgatggacccggccaaggccaagggtgcgcagatggtcgacgcattggcg
gatgacccggttgccgccgccaaggaatgggtgctgaacgccaaggatgccgatctggtc
aaaccctgggacgccaagggctacaagatgcccggcggcgccccctatcatccggcgggt
ttcatgacctttgtcggcgcctcggccatggtcaacggcaagacccaaggcgccttcccc
gcgcccaaggcactgctgagcgccatctacgagggcgcgctggtcgatttcgacaccgcg
ctgcgcattgaggcacgctggttcacccatgtgctgatgaacccctcctcctcggccatg
atccgcagcctcttcatcaacaagcaggcgctggagaaaggcgcggtgcggcccaaggac
atccccgaccagcgggtcaagaaactcggcgtgctgggcgcgggcatgatgggcgcgggc
atcgcgctggtcagcgcgcaggcaggtatggaggtcgtgctgatcgaccgtgaccaggcc
gccgccgacaagggcaaggcctataccgaagcttacctcgacaaggggatgaagcgcggc
aaggtcaccgccgagaagaaagaggcgatgctgggcctgatcaccgccaccccggatctg
gacgcgctgaaaggctgtgacctgatcatcgaggcggtgttcgaggatccgggcgtgaag
gccgagatgaccaagaaggtcgaggcgatcatccccgaggactgcatctttgcctccaac
acctcgaccctgccgatcaccggtttggccaaggcaagcgtgcggcccgaacagttcatc
ggcatccacttcttctcgccggtcgagaagatgctgctggtcgagatcatcaagggcaag
gaaaccggcccgcgggcggtggccaaggcgctggattacgtgcgccagatccgcaagacc
ccgatcgtggtcaatgatgcgcgtttcttctactgcaaccgctgcatcattccgtatgtc
aacgaaggcgcgcggatgatcaccgagggcgtgtcgccggtgctgatcgacaatgcggcg
cggcagctgggtttcccggtgggtccgatccagctgaccgacgaaacctcgattgatctc
ggcgccaagatcgcgcgggcgaccaaggcggcgatgggcaatgcttatcccgaaagcccg
gctgacgacctgatcttctggatggaagagctgggccggatgggccgcaaggccaacgcg
ggcttcttcgattatgacgacaagggcaagcgcaccggctattggcagggcctgcaggac
aagtacccgctggccgaagagcagcccgacctgatcgaggtgcaggaacgcctgatgttc
gcgcaggtgctggaagcggtgcgtgcgctggaagaaggcgtgctggaagacatccgcgaa
ggcgacgtgggcgccatcctggcctggggctttgccccttggtcgggcggcccgctcagc
tggatcgacatcatcggcacgccctacgcggcggatcgctgtgaccagttggcggcgaaa
tacggcgagcgcttcgcctgcccgccgctgctgcgcgaaatggccgacaaggggcagagc
ttctacgggcgttttgaccccgaggcgaaatcggcggcctga

DBGET integrated database retrieval system