KEGG   Ruegeria pomeroyi: SPO2929Help
Entry
SPO2929           CDS       T00215                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00240  Pyrimidine metabolism
sil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPO2929 (deoA)
Enzymes [BR:sil01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SPO2929 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AAV96170
UniProt: Q5LPB9
Position
complement(3127796..3129106)
Genome map
AA seq 436 aa AA seqDB search
MDARAIIARLRRHEVPSAAELTWFAQGLADGSVSDAQAGAFAMGVCMGRLGSEGRAALTL
AMRDTGDVLHWDFDGPVIDKHSTGGVGDCVSLVLAPALAECGTYVPMISGRGLGHTGGTL
DKMEAIPGVTTQLGPDRLAQVVRDTGAAIVGATARIAPADKRLYAIRDVTATVESLDLIT
ASILSKKLAASPDALVLDVKLGSGAFMKSPDEARALALALTETANAAGCRTSALITDMSQ
PLAPSLGNALEVGEVMRVLTSGHADDPLAQLSAELGGVLLSDAGLATDAVSGAARIAAII
SDGRAAERFGRMIAAVGGPVQFVENWQRFLPEATVIREVPARASGYVTAIDGEVLGLAVV
ALGGGRQVETDVVDPAVGLSRVIRLGTAVNPGTPLATIHAARQEAAEAAEATLRAAITIG
PEPVAAPPLIHERITP
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggacgcccgcgccatcattgcccggctcaggcgccacgaggtgcccagtgcggctgaa
ctgacctggttcgcccaaggccttgccgatggtagtgtcagcgatgctcaggcgggcgcc
tttgccatgggtgtttgcatgggtcggcttggctctgaggggcgcgcggcgctgacattg
gccatgcgcgataccggcgatgtgctgcactgggatttcgacgggccggtgatcgacaag
cattccaccggcggggtgggagattgcgtcagtctggtgctggcgcccgcgctggccgaa
tgcggtacctatgtgccgatgatctcgggccgggggctgggccataccggcggtacgctc
gacaagatggaggcgatccccggcgtcaccacccagcttgggcctgaccggctggcgcag
gtggtacgcgataccggcgctgccatcgttggcgccaccgcgcgcatcgcgcccgccgac
aagcggctctatgccatccgcgatgtgaccgccacggtcgaaagcctcgatctgatcacc
gcctcgatcctgtccaagaaactggccgccagccccgatgcgttggttctggacgttaaa
ctgggcagcggcgccttcatgaaatcgccggacgaggcgcgcgcgctggcccttgccctg
accgagaccgccaatgccgctggctgccggacctcggccctgatcaccgatatgagccag
ccgctggcgcccagcctcggcaacgcgctcgaggtgggcgaggtgatgcgggtgctgacc
tctggtcacgctgatgacccgctggcacaactctcggcggagctgggcggcgtgctgctc
tctgatgcggggctggcaacggatgcggtcagcggggccgcgcgcattgctgccatcatc
tcagacggtcgcgcggccgaacgctttggtcgcatgatcgcggctgtcggcgggccggtg
caatttgtcgagaactggcagcggttcctgcccgaggcaaccgtgatccgcgaggttccc
gcccgcgcgtcaggctatgtcaccgccatcgacggcgaggtgttgggccttgccgtggtg
gcgctgggcggcgggcggcaggtcgagaccgatgttgttgacccggcggttggcctgtca
cgggtgatccggctgggcacagcggttaacccaggcaccccgctcgccaccatccacgcc
gcaaggcaagaggcggcagaggcagccgaggccaccctgcgcgcggcgatcaccatcggg
ccagagccggtggccgcgccaccgcttatccatgaaaggatcacgccatga

DBGET integrated database retrieval system