KEGG   Ruegeria pomeroyi: SPO3746Help
Entry
SPO3746           CDS       T00215                                 

Gene name
ade
Definition
(GenBank) adenine deaminase
  KO
K01486  adenine deaminase [EC:3.5.4.2]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00230  Purine metabolism
sil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sil00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPO3746 (ade)
Enzymes [BR:sil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.2  adenine deaminase
     SPO3746 (ade)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenine_deam_C Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AAV96967
UniProt: Q5LM18
Position
complement(3957061..3958872)
Genome map
AA seq 603 aa AA seqDB search
MEPTTFPSWADVAPRLVAVAAGREPADMIIRNGTWINVHTREALPGHSIAIAEGRIAFVG
PDASHCSGPDTRIIEANGRYMIPGLCDGHMHIESGMLTPAEFAAAVIPHGTTTMFTDPHE
IANVLGLAGVRMMHDEALMQPVNIFTQMPSCAPSAPGLETTGYEITPEDVAEAMTWPGII
GLGEMMNFPGVTNADPKMLAEIAATQRAGKTVGGHYASPDLGPAFAAYVAGGPADDHEGT
CEADAIARVRQGMRSMMRLGSAWYDVETQITAVTEKGLDPRNFILCTDDCHSATLVNDGH
MNRVVRHAIACGCDPLIALQMATINTATHFGLERELGSTAPGRRADVILTSDLRDLPIEL
VIARGQVVAENGKIAVDCPHYDWPDTARGTVHLGHALSARDFEIAAPTGANRVRANVIGV
VENQAPTKALKAELPVREGLVETAEHPDDVCQIALVERHRATGGVTNAFVSGFGYQGRMA
MASTVAHDSHHMIVVGTDREQMALAANRLAEVGGGITIWRDGQELALVELPIAGLMSDSP
AAEVAAKAQAMVEAMAACGCTLNNAYMQHSLLALVVIPELRISDLGLIDVRSFERIDLLE
PLA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaacgacttttcccagctgggccgatgtggccccccgcctggtcgccgtcgcc
gcaggccgcgaaccggcggacatgatcatccgcaatggcacctggatcaacgtgcacacg
cgcgaggcgcttccgggccattccatcgcgattgccgaggggcgcatcgcctttgttggc
ccagatgccagccattgctccggccccgacacccggatcatcgaggcgaacgggcgctac
atgatcccgggcctctgcgacgggcatatgcatatcgaaagcggcatgctgaccccggcc
gagtttgccgccgccgtcatcccgcatggcaccacaaccatgttcaccgacccgcatgag
atcgccaatgtccttggcctagccggtgtgcggatgatgcatgacgaggcgctgatgcag
cccgtcaacatctttacccagatgccctcctgcgcgccctcggcgccgggactggagacc
accgggtatgagatcacgcccgaggatgtggccgaggcgatgacctggcccggcatcatc
ggcctgggcgagatgatgaactttcccggtgtcaccaatgccgaccccaagatgctggcc
gagatcgccgcgacccagcgcgcgggcaagacggtgggcgggcattatgcctcgcccgat
ctgggccctgcctttgccgcctatgttgcgggcgggcctgcggacgatcacgaaggcacc
tgcgaggctgacgccatcgcccgggtgcgccagggcatgcgcagcatgatgcggctgggc
agcgcctggtatgacgtggaaacccagatcactgcggtgacggaaaaggggctcgatccg
cgcaacttcatcctgtgtaccgacgattgccattcggccacgctggtaaacgatggccat
atgaaccgggtggtgcgccatgccatcgcctgtggctgcgacccgctgattgccctgcaa
atggcgacgatcaacaccgccacccatttcgggctggagcgcgagctgggctcgaccgca
ccgggtcggcgcgccgatgtgatcctcacctcggacctgcgcgacctgcccatcgaactg
gtgatcgcgcgagggcaggtggtggccgagaacggcaagattgccgtcgattgtccccat
tacgactggcccgacacggcccggggtaccgtgcatctgggccatgcgctaagcgcgcgc
gatttcgagatcgcggccccaaccggcgccaaccgggtccgcgccaatgtgatcggggtg
gtggaaaaccaggcgccgaccaaggcgctgaaagcggagctgccggtgcgagaagggctc
gtagagaccgccgagcaccccgatgacgtctgccagatcgcgctggtcgaacgccaccgg
gccaccggcggcgtcaccaatgcctttgtctcgggcttcggctatcagggccgcatggcc
atggcctcgaccgtggcgcatgacagtcaccacatgatcgtggtcggcaccgaccgagag
cagatggcactggccgcgaaccggctggccgaggtcggcggcggcatcaccatctggcgc
gacggtcaggaactggcgctggtggaactgcccatcgcggggctgatgtccgacagcccc
gccgccgaggtcgccgccaaggcacaggccatggtcgaggcgatggccgcctgcggttgc
acgctcaacaacgcctatatgcagcattcgctgcttgcactggtggtgatccccgaattg
cgcatctcggatctgggcctgatcgacgtgcgcagttttgaacggatcgacctgctggag
ccgcttgcatga

DBGET integrated database retrieval system