KEGG   Ruegeria pomeroyi: SPOA0055Help
Entry
SPOA0055          CDS       T00215                                 

Definition
(GenBank) cytochrome c family protein
  KO
K08738  cytochrome c
Organism
sil  Ruegeria pomeroyi
Pathway
sil02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sil00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SPOA0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: AAV97195
UniProt: Q5LLH2
Position
megaplasmid:50513..50890
Genome map
AA seq 125 aa AA seqDB search
MFKNRLILTILAAGLALPALADGDADKGKKVFNKCKACHAVGEGAANKVGPQLNGIIGAA
AGQVEGFKYSDALIEAAAGGLVWDDESLAAFLAKPKDFMKGTKMSFAGLKKEDEIENVIA
YLQGF
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaaccgactgatcctgaccattctggccgcagggctggcgctgcccgccctg
gccgatggcgatgccgacaagggcaagaaagtgttcaacaagtgcaaggcctgccatgcg
gtcggcgagggcgcggccaacaaggtcgggccacagctgaacggcatcatcggtgccgcc
gccggtcaggtcgaagggttcaagtattccgacgccctgatcgaggccgccgcagggggt
ctggtctgggacgacgagagcctggccgcgtttctggccaagcccaaggatttcatgaag
ggcaccaagatgtcctttgccgggctcaagaaggaagacgagatcgaaaacgtcatcgcc
tatttgcaaggattctga

DBGET integrated database retrieval system