KEGG   Ruegeria pomeroyi: SPOA0163Help
Entry
SPOA0163          CDS       T00215                                 

Gene name
mvaA
Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00900  Terpenoid backbone biosynthesis
sil01110  Biosynthesis of secondary metabolites
sil01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sil00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPOA0163 (mvaA)
Enzymes [BR:sil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SPOA0163 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AAV97299
RoseoBase_p: mvaA
UniProt: Q5LL64
Position
megaplasmid:complement(179002..180303)
Genome map
AA seq 433 aa AA seqDB search
MTGKTGHIDGLNSRIEKMRDLDPAQRLVRVAEAAGLEPEAISALAGNGALPLSLANGMIE
NVIGKFELPLGVATNFTVNGRDYLIPMAVEEPSVVAAASYMARIARENGGFTAHGTAPLM
RAQIQVVGLGDPEGARQRLLAHKAAFMEAADAVDPVLVGLGGGCRDIEVHVFRDTPVGAM
VVLHLIVDVRDAMGANTVNTMAERLAPEVERIAGGTVRLRILSNLADLRLVRARVELAPE
TLTTQGYDGADVARGMVEACALAIVDPYRAATHNKGIMNGIDPVVVATGNDWRAIEAGAH
AYAARTGHYTSLTRWELANDGRLVGTIELPLALGLVGGATKTHPTARAALALMQVETATE
LAQVTAAVGLAQNMAAIRALATEGIQRGHMTLHARNIAIMAGATGADIDRVTRVIVEAGD
VSVARAKQVLENT
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcaagacgggtcacatcgatggtttgaactcgcgcattgaaaagatgcgagat
ctcgaccccgcacaacggctggtgcgcgttgccgaggcggcgggcctcgagcccgaggcg
atcagcgcgctggcgggtaacggcgccctgcccctctcgctggccaacgggatgatcgag
aacgtcatcggcaaattcgaactgccgctgggcgtggccacgaatttcactgtgaacggc
cgcgactatctgatcccgatggcggtcgaagagccctcggtggtggcggccgcgtcctat
atggcgcgtatcgcgcgcgagaatggcggattcaccgcgcatggcaccgcgcccttgatg
cgcgcccagatccaggtggtcgggttgggtgatcccgagggcgcccggcagcgtctcctc
gcccacaaggccgcgttcatggaggcggcggacgctgtcgatccggtgcttgtcgggctg
ggtggcggctgccgcgatatcgaggttcacgtgttccgggatacgccggtgggcgcgatg
gtcgtcctgcacctgatcgtcgatgtgcgcgacgcgatgggggccaatacggtcaacacg
atggccgaacggctggcccccgaggtcgagcggattgccggtggcaccgtgcggctgcgc
atcctgtcgaacctcgccgacctgcgattggtccgggcgcgggtggaactggccccggaa
acactgacaacgcagggctatgacggcgccgacgtggcgcggggcatggtcgaggcctgc
gcgcttgccatcgtcgacccctatcgcgcggcgacccataacaaggggatcatgaacggc
atcgacccggtcgtcgtcgccaccggcaatgactggcgcgcgatcgaggcgggtgcccat
gcctatgccgcccgcacgggtcattatacctcgctgacccgctgggaactggcgaatgac
gggcggcttgtgggcacgatcgaactgcccctggcgcttggccttgtcggcggcgcgacc
aagacgcacccgaccgcacgggcggcgctggccctgatgcaggtagagactgcaaccgaa
ctggcccaggtcaccgccgccgtgggtctggcgcagaacatggccgccatccgcgcgctg
gcgaccgaaggcatccagcgcggtcacatgacccttcatgcgcgcaacatcgcgatcatg
gccggcgcaacaggcgccgatatcgaccgcgtcacccgggtcattgtcgaagcgggcgac
gtcagcgtggcccgtgcaaaacaggtgctggaaaacacctga

DBGET integrated database retrieval system