KEGG   Ruegeria pomeroyi: SPOA0260Help
Entry
SPOA0260          CDS       T00215                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00040  Pentose and glucuronate interconversions
sil00053  Ascorbate and aldarate metabolism
sil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPOA0260
   00053 Ascorbate and aldarate metabolism
    SPOA0260
Enzymes [BR:sil01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     SPOA0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AAV97394
UniProt: Q5LKW9
Position
megaplasmid:complement(285382..286890)
Genome map
AA seq 502 aa AA seqDB search
MFKPHGRHLIAGKWVDGDDSFSSEPAHGPSHRFAVGRVADVDAAATAAENAFWSFASSTR
AARADLLTAIADEIDACGGAITEIGTQESGLPEARLIGERGRTTGQLRLFATHILKGDYL
DRRHDAALPDRQPLPRPDLRMIQRPIGPVAVFGASNFPLAFSTAGGDTAAALAAGCPVVV
KAHGAHPGTSEIVAEAVKAAIERCGFHPGVFGLIQGGNRQVGAALVQHPLIKAVGFTGSL
GGGRALFDLCAARPEPIPFFGELGSVNPMFIFAGALANRGSAIAQGWAGSLTMGAGQFCT
NPGVAVMLAGPNADAFAQSAAEALAQVAPQTMLTDGIAEAYRAGQRRMGAATGVRELLST
PCDQRSAAPSLYATTAKAWLANEELAEEVFGPLGMIVTADSVEEMLAIARDLQGQLTCTV
HVDAEDAAAATRFMPVLERKAGRILANGFPTGVEVSDTMVHGGPYPASTNFGATSVGTLS
IRRFLRPVCYQDMPEGLLPADL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaccacatggaagacacctgatcgcgggcaaatgggtcgatggtgacgatagc
ttttcgtcagagcctgcgcatgggccatcgcaccgctttgcggttggacgcgtcgccgat
gtggacgcggcagcaaccgccgccgaaaacgccttctggagctttgccagctcgacccgg
gcagcgcgcgccgacctgttgactgccatcgctgacgaaatcgacgcatgcggcggtgcg
atcactgaaatcggcacccaggaaagcggcctgcccgaagcgcgcctgatcggtgaaaga
ggccggaccacggggcagctgcggctgtttgcgacccatattttgaagggcgattatctt
gatcgccgtcacgatgcggcgctgccggaccgccagcctttgccccgccccgatctgcgg
atgatccagcgaccgatcggccccgttgccgtgttcggggcgtcgaacttcccgcttgcc
ttctcgacagcgggtggcgacaccgccgctgcgctggcggccggctgtcctgttgtggtc
aaggcacatggcgcacacccgggcaccagcgagattgtcgccgaggcggtcaaggctgcc
atcgagagatgcgggtttcaccctggtgtctttggtctgatccaaggcggcaaccgtcag
gttggcgcggccctggtacagcaccccctgatcaaggccgtcgggtttaccggatcccta
ggcggcgggcgggcgctgttcgatctgtgcgcggcccgtcccgaacctatcccgttcttc
ggcgagttgggttcggtcaatccgatgttcatcttcgcgggggcgcttgcgaaccgaggc
agcgccattgcgcaaggatgggcaggttccttgacgatgggcgcgggccagttctgcacc
aatcccggcgtcgcggtgatgttggcaggacccaacgccgacgcctttgcccaaagcgca
gccgaggccctggcacaggtggctccgcagacgatgctgaccgatggtattgccgaggcc
tatcgcgccggtcagaggcgcatgggcgcggcaaccggtgtgcgtgagcttttgagcaca
ccctgcgatcagcgcagcgcagcgccgagcctttatgcaaccacggcaaaggcttggctg
gccaacgaagaactggccgaagaggtctttggcccgcttggaatgattgtgaccgcggac
tcggtcgaagaaatgcttgcgatcgcgcgcgatctgcagggtcagctgacatgcaccgtt
catgtggatgcagaggatgccgccgccgccacccgtttcatgccggttcttgaacgcaag
gcgggcaggatactggccaacggtttcccgaccggtgtcgaggtcagcgatacgatggtt
cacggcggcccctatccggcctcgaccaactttggcgcaacctccgtcggaaccctgtcc
attcgccggtttcttcggcctgtttgctatcaggacatgcccgagggtctgctacctgcg
gatctttga

DBGET integrated database retrieval system