KEGG   Ruegeria pomeroyi: SPOA0425Help
Entry
SPOA0425          CDS       T00215                                 

Definition
(GenBank) acetyl-CoA acyltransferase/thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00071  Fatty acid degradation
sil00072  Synthesis and degradation of ketone bodies
sil00280  Valine, leucine and isoleucine degradation
sil00310  Lysine degradation
sil00362  Benzoate degradation
sil00380  Tryptophan metabolism
sil00620  Pyruvate metabolism
sil00630  Glyoxylate and dicarboxylate metabolism
sil00640  Propanoate metabolism
sil00650  Butanoate metabolism
sil00900  Terpenoid backbone biosynthesis
sil01100  Metabolic pathways
sil01110  Biosynthesis of secondary metabolites
sil01120  Microbial metabolism in diverse environments
sil01130  Biosynthesis of antibiotics
sil01200  Carbon metabolism
sil01212  Fatty acid metabolism
sil02020  Two-component system
Module
sil_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:sil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPOA0425
   00630 Glyoxylate and dicarboxylate metabolism
    SPOA0425
   00640 Propanoate metabolism
    SPOA0425
   00650 Butanoate metabolism
    SPOA0425
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPOA0425
   00072 Synthesis and degradation of ketone bodies
    SPOA0425
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPOA0425
   00310 Lysine degradation
    SPOA0425
   00380 Tryptophan metabolism
    SPOA0425
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPOA0425
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPOA0425
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPOA0425
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sil04147]
    SPOA0425
Enzymes [BR:sil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPOA0425
Exosome [BR:sil04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPOA0425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt NUC153 ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAV97556
UniProt: Q5LKF6
Position
megaplasmid:complement(471770..472978)
Genome map
AA seq 402 aa AA seqDB search
MATPAYIYDALRTPRSRGKASGALYEVKPIQLAAGLLREMQARHDMDTSRVGDVILGCTA
PVGDQGACVAKAAVQAAHWDEAVPGVQLDRFCASGLEAVNMAAAKVGSDQEELVVAGGIE
SMSRIPMLSQGGAMFTDPDFVIDQNSAPQGIGADLIATIDGYSREDVDAFAMESQRRAAH
ARDSGWFDRSVVPVRDENGLTILERDDFIKPDTDMQKLGALNPSFAGMGAFGYDDMALAK
YPQVARINHVHTPGNSSGIVDGSSAVLIGSEKAGRDLGLEPRARIVSATVIATDPVIMLA
GPGPAAKKCLDKAGLKVSDIDIWEINEAFASVALRYMKDLDIDHEITNVNGGAIAMGHPL
GATGGMLVSTVLDELERRGAKRAMISLCVGGGMGISTLIERL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacccgcctatatctacgacgcgctgcgcacgccccgctcgcgcggcaaggcc
agcggcgcgctttacgaagtgaagccgatccagctggccgccggcctgctgcgcgagatg
caggcgcgccacgacatggacacgtcgcgcgtaggcgacgtgatcctgggctgcactgcg
ccggtgggcgatcagggcgcctgtgtcgccaaggcagccgtgcaggcggcccattgggac
gaggcggtgccgggtgtccagcttgaccgcttctgcgcctcggggcttgaggcggttaac
atggccgccgccaaggtgggttccgatcaagaggagctggtggtcgcgggcggtatcgaa
tcgatgagccgcatccccatgctcagccagggtggcgcgatgttcaccgaccccgatttc
gtgatcgaccagaactcggccccgcagggcatcggcgccgacctgatcgccaccatcgac
ggttacagccgcgaggatgtggacgcattcgcgatggaaagccaacgccgcgccgcgcat
gcccgcgacagcggctggttcgaccgctcggtggtgccggtgcgcgatgaaaacggcctg
accatcctcgagcgggacgatttcatcaaacccgacaccgacatgcagaaactgggcgcg
ctgaacccctcgttcgcgggtatgggcgcctttggctatgatgacatggcgctggccaag
tatccccaggtggcccgcatcaaccatgtgcatacgcccggcaatagctcgggcattgtc
gacgggtcatccgccgtgctgatcggctcggagaaggcggggcgcgatctggggctggaa
ccgcgcgcgcgcatcgtctcggccaccgtcatcgccaccgatccggtgatcatgctggcg
ggccccggcccggcggccaagaaatgcctcgacaaggcggggctgaaggtctcggacatc
gacatctgggaaatcaacgaggccttcgcctcggtcgcgctgcgctacatgaaggatctg
gatatcgaccacgagatcaccaatgtgaacggcggcgccatcgccatgggccacccgctg
ggtgccaccgggggcatgctggtttcaaccgtgctcgacgagctggagcgccggggcgcc
aaacgggcgatgatctcgctctgtgtcggtggcggcatgggcatctcgaccctgatcgaa
cgtctgtaa

DBGET integrated database retrieval system