KEGG   Sulfolobus islandicus M.16.27: M1627_0916Help
Entry
M1627_0916        CDS       T00900                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
sim00010  Glycolysis / Gluconeogenesis
sim00620  Pyruvate metabolism
sim00640  Propanoate metabolism
sim00680  Methane metabolism
sim00720  Carbon fixation pathways in prokaryotes
sim01100  Metabolic pathways
sim01110  Biosynthesis of secondary metabolites
sim01120  Microbial metabolism in diverse environments
sim01130  Biosynthesis of antibiotics
sim01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M1627_0916
   00620 Pyruvate metabolism
    M1627_0916
   00640 Propanoate metabolism
    M1627_0916
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M1627_0916
   00680 Methane metabolism
    M1627_0916
Enzymes [BR:sim01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     M1627_0916
Lipid biosynthesis proteins [BR:sim01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   M1627_0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACP54848
UniProt: C3N4C3
Position
889581..891332
Genome map
AA seq 583 aa AA seqDB search
MWERKRYINRRGILLYMRNMVEIIREKKIILRPNLENYEEVRKNFSWSKVREELNYNGDV
NAAELAIHKKGELGDKYGILWVSEEEEKRKYTFRDLERRGATFRRVLEDNGVRSGDRVVI
MSKRVPALYFSFVAIGMLGSVILPIFSTFGEDAIRYRVENSGAKVAIVHESLAEKFRNIH
GIKILKITDDGIEGESNRGVEISYTKRSINDPFLILYTSGTTGKPKGIWHSQDILTFYYV
SGKYHFDMHPQDVFWHTGDPAWVAGFAGVWTAWVNGIPLVSYEGRFKAETWYSNIQEYRV
SVISTAPTALRLLKKEGLELAKKYDLSSVRFVHAGGEYVDPDTVKAGIEIFGVPVHDGYG
QTETATYVIANFISMPIKIGSMGKPLPGVEAVIVDENGNPLPPNTQGILALKPDFPAMAR
GIWGDEERWKRNFKNGYYLTGDTAYVDEDGYFWYLGRSDDVIKVSGYRVSPIEIESVIAT
HPAVAEAGVIALEDPVRGHKIKAYIVLKKNYEPSEELKQQIQNYVRERLAAHMVPREIEF
VSELPHTLSGKIMRRVLKAMESGREIGDISTLENPEIVKKSKE
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaaagaaaaagatatataaataggagaggtattttattgtatatgaggaacatg
gtagagattataagggagaagaagataattttaagacctaatctggaaaactatgaagaa
gttaggaagaactttagttggagtaaggtaagagaagagttaaattataatggtgatgtc
aacgcagcagaactggcaatacataagaaaggtgaactaggagataaatacggtatccta
tgggttagtgaggaggaagaaaaaaggaaatatacttttagagatttggaaaggagaggt
gctacattcagaagagttttggaggataatggggtaaggagtggcgatagggtagtaatt
atgtctaaaagggtcccagcgctctacttctcctttgtagcaataggaatgttgggtagc
gttatacttcccattttctccacatttggtgaagacgcaataaggtatagggttgaaaat
agcggtgctaaagttgcaatagtgcacgagtcgttagcggaaaagtttaggaacattcat
gggattaagattttgaagattacagatgacggcatagagggagagagcaataggggagtc
gagatttcatacactaagaggtctattaatgatccatttttgatcttatatacctctggg
actacgggaaagcctaaaggtatttggcactctcaagatatattgacgttttactatgta
tcgggtaaatatcatttcgatatgcatccccaagatgtcttctggcatactggagaccct
gcgtgggtagctggatttgctggagtttggaccgcgtgggttaatggtataccgttagtc
tcctatgagggcaggtttaaagctgagacgtggtatagtaatattcaagagtatagggtt
tcagtaatttcaactgccccaactgccttgaggttgttgaagaaggagggattagaatta
gccaaaaagtacgatctctcctcagttagatttgtccacgctggaggagagtatgttgat
cctgataccgtaaaagcgggaattgagatattcggtgttccagttcacgatggatatggg
caaacggaaactgcaacttacgttatcgctaacttcatttcaatgccgataaaaattggt
tccatgggaaagcccctccctggagttgaagctgtgatagtggacgagaacgggaatccg
cttcctccaaatacacaaggtatactagctctaaagccggattttccagcaatggctaga
ggtatatggggagacgaggagaggtggaaacgtaatttcaagaatggatattacttaact
ggagacacagcgtatgttgatgaagatggatacttctggtatttagggagatccgatgac
gtgattaaggtatctggatatagggttagtccaatagagatagagagtgtaattgcgact
catcctgctgtggcggaagctggagttatagctttagaggatccagttagagggcataag
atcaaggcatatatagttctcaagaagaactatgaaccatctgaagagcttaaacaacag
atccaaaactacgttagggagagattagctgctcacatggtacctagggaaatagagttt
gtaagcgaattacctcatacattgagtggaaaaataatgaggagagtattgaaggctatg
gaaagtggtagggagataggtgatattagcactttagaaaacccagaaattgtaaagaaa
tcaaaagaataa

DBGET integrated database retrieval system