KEGG   Sulfolobus islandicus M.16.27: M1627_1645Help
Entry
M1627_1645        CDS       T00900                                 

Definition
(GenBank) seryl-tRNA synthetase
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
sim00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sim00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    M1627_1645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sim01007]
    M1627_1645
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sim03016]
    M1627_1645
Enzymes [BR:sim01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     M1627_1645
Amino acid related enzymes [BR:sim01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   M1627_1645
Transfer RNA biogenesis [BR:sim03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    M1627_1645
 Prokaryotic type
    M1627_1645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N FYRC Spectrin YkyA
Motif
Other DBs
NCBI-ProteinID: ACP55525
UniProt: C3N6A0
Position
complement(1549715..1551088)
Genome map
AA seq 457 aa AA seqDB search
MSWSILEFLRKNPEELKNNLKRRAIDVSLVDKAVELDKKWRQVLQEVERLRHQHNVLSSQ
IPKLSGEERKKKIEESKNLLKILEDKEKELEKIEVERDRLLSSLPNLVADDVPNGPDDSY
NIPIKFWGKFKVYEGDVEEFLRQTKDANVNYEIIKWKPKGHAEMLEDVLHLGNTLKAAEI
AGSRFYYLFNDIVWLDFALLLFAIDYITQQGYTLVLPPYMLRGEVIQSVIDLDTFKDAIY
KIENEDLYLIATAEHSIAAMFFKEEIEKDKLPLKFAGISPAFRKEAGAANKDLKGIFRVH
QFHKVEQFIFSTPEDSWKYHAELITNAESIFQQLELPYRIVNIASGDLGACAAKKFDLEV
WMPAQAKFREMVSCSNCTDWQAFRMKIRYVDRKNNKRGYVHTLNSTAIASTRTITAILEN
YQREDGVVEVPKVLRKYLEIFPKAPKDYIYPLKNKII
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggagtatcctagagtttttgcgaaaaaatccggaggaactaaaaaataatttg
aaaagacgggctatagatgtttctttagtagacaaagctgtcgaactagataaaaagtgg
agacaagttttgcaagaagttgaaagattaaggcatcaacacaatgttttaagctctcag
attcctaagctctctggagaagaaagaaagaagaaaattgaggaaagcaaaaatttattg
aaaatcttagaggataaagaaaaggaattggagaaaatagaggttgaaagagatagatta
ctatcgtctctgccaaaccttgtagctgatgatgtcccaaatggtccagacgatagctat
aatattcctatcaagttttggggaaagtttaaagtgtatgagggagatgttgaagaattt
ctgaggcaaactaaagatgctaatgtaaactatgaaataattaaatggaaacctaaaggg
catgcagaaatgctagaggacgtattgcatttagggaacacactcaaagctgctgaaata
gcggggtctagattttactatttatttaatgatatagtttggctagatttcgcgttatta
ctcttcgcgatagattatatcactcaacaagggtacactttagttcttcctccttatatg
ctaaggggagaagttatacaatcagttatcgacctagatacatttaaggatgcaatatac
aagatagaaaacgaggatttatatctaattgcaactgcagaacattcaatagcagccatg
ttctttaaagaggaaattgagaaagataaattacccctaaaatttgctggaatcagtccc
gcttttagaaaagaggctggtgctgcaaacaaggatttaaagggaattttcagagttcat
caatttcacaaggttgagcaattcatattttcaaccccagaagatagttggaagtaccat
gctgaactaataacaaatgctgagagtatatttcaacaacttgaattaccatatagaatt
gtaaatatagcatcaggtgatttaggtgcatgcgctgcaaagaaatttgacttagaagta
tggatgccagctcaagccaaatttagagaaatggtaagttgtagtaattgtacagattgg
caagctttcagaatgaagataagatatgtggataggaagaataataagagaggttatgtg
catacgttaaatagtactgcaattgccagcacaagaaccataacggctattttagagaat
tatcaaagagaggatggagtagtcgaggtaccaaaggtattaagaaaatatcttgaaata
tttccgaaagctcctaaagattacatatatccattaaaaaataagataatttaa

DBGET integrated database retrieval system