KEGG   Sulfolobus islandicus M.16.27: M1627_1857Help
Entry
M1627_1857        CDS       T00900                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
sim00790  Folate biosynthesis
sim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M1627_1857
Enzymes [BR:sim01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     M1627_1857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ACP55729
UniProt: C3MZ97
Position
complement(1742404..1743030)
Genome map
AA seq 208 aa AA seqDB search
MQKTELDDQKLVEEIARRIREILELLGENPEREGLKETPERVAKALLEMTSGLRTPPPQI
KVFSLGEDGEVYEKNQIVLIKDVNFSSLCEHHMLPIIGKIHVAYIVSNSGKVAGFSKIIR
IVNYYSSRLQIQERLVEQIADAIMNSEIKPKGVMVIGNAIHMCSYVRGVKDKEAKLVSVA
YRGLFKTNRALQNHVFRLLDNANKVNLL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagacagaattagatgaccaaaaactagtagaagaaatagctagaaggattaga
gaaattctcgaactactgggtgagaatccggaaagagaagggcttaaagagacacctgaa
agagtagcaaaggctttattagaaatgacctcaggattgagaacgccaccccctcaaata
aaggtattcagtttaggcgaagatggtgaagtatacgaaaagaaccaaatagtactaata
aaagacgttaacttttcgtcattgtgtgagcatcatatgttgccaatcattggaaaaatt
catgtagcgtacattgttagtaatagtggcaaggttgctggttttagcaaaataattaga
attgtaaattattactcatcccgtcttcaaattcaagagaggttagtagagcaaatagct
gatgctataatgaatagcgaaataaaacctaaaggtgttatggtgatcgggaacgcaata
catatgtgttcatatgtcagaggagtaaaggataaagaggccaagttagtttcagtagca
tacagagggctgtttaagactaatagagctttacaaaatcatgtcttcaggttactcgat
aatgcaaataaggtaaacttattatag

DBGET integrated database retrieval system