KEGG   Sulfolobus islandicus M.16.27: M1627_2772Help
Entry
M1627_2772        CDS       T00900                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
sim00010  Glycolysis / Gluconeogenesis
sim00051  Fructose and mannose metabolism
sim00562  Inositol phosphate metabolism
sim01100  Metabolic pathways
sim01110  Biosynthesis of secondary metabolites
sim01120  Microbial metabolism in diverse environments
sim01130  Biosynthesis of antibiotics
sim01200  Carbon metabolism
sim01230  Biosynthesis of amino acids
Module
sim_M00002  Glycolysis, core module involving three-carbon compounds
sim_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M1627_2772
   00051 Fructose and mannose metabolism
    M1627_2772
   00562 Inositol phosphate metabolism
    M1627_2772
Enzymes [BR:sim01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     M1627_2772
Exosome [BR:sim04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   M1627_2772
  Exosomal proteins of bladder cancer cells
   M1627_2772
  Exosomal proteins of melanoma cells
   M1627_2772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG NMO FMN_dh His_biosynth DUF561 IGPS G3P_antiterm DHO_dh Glu_synthase IMPDH Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ACP56609
UniProt: C3N3N5
Position
complement(2616334..2617017)
Genome map
AA seq 227 aa AA seqDB search
MKPPIIVINFKAYENSFGNKAIELGKKIEKISKEYSVEIILSVPATMIYRMVQEVDLPIY
AEHVDPVPLGAYTGAVLPEMIKDADAKGTLINHSERRLRADEIDDVLKRTRKLGLSSILC
VDRYELVYPFSLLRPDAILIEPPELIGTGISVSKAKPEVITKAVDEIRKSEGIYLIAGAG
ITTGEDVYKALKLGAHGIGVASAVMKAKEPEKVVEDFITSALKAISS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccccctattattgtaataaactttaaggcctacgaaaactcctttggtaataag
gcaattgagttaggtaaaaagatagaaaaaataagtaaggagtattcagttgaaataata
ttgtcagtaccagctactatgatctacagaatggtccaagaggtagatttaccaatttat
gctgaacatgtagatccagttcctttaggcgcttatacgggagccgtattaccagaaatg
ataaaagatgcagatgctaaagggacattgataaatcacagtgagagacgtctaagggct
gatgaaatagatgacgtattaaaaagaactaggaaattaggtttgagtagtatactatgc
gttgacagatatgagttagtctatccctttagtttactaaggcctgatgcaattttgata
gagcctccagaattgataggaaccggtatctcagtatctaaagccaaacctgaggtaata
acaaaagccgtggatgagataagaaagtctgaggggatctatttaatagcgggtgctgga
attacaaccggtgaggacgtttataaagcgttaaagctaggagctcatggaataggtgta
gcaagtgcagtcatgaaggctaaagaacctgagaaagttgttgaagattttatcacaagt
gcattgaaggctatctcttcttag

DBGET integrated database retrieval system