KEGG   Simplicispira suum: C6571_04545Help
Entry
C6571_04545       CDS       T05361                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
simp  Simplicispira suum
Pathway
simp00471  D-Glutamine and D-glutamate metabolism
simp00550  Peptidoglycan biosynthesis
simp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:simp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    C6571_04545
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C6571_04545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:simp01011]
    C6571_04545
Enzymes [BR:simp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     C6571_04545
Peptidoglycan biosynthesis and degradation proteins [BR:simp01011]
 Precursor biosynthesis
  Amino acid ligase
   C6571_04545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AVO40651
UniProt: A0A2S0MY61
Position
complement(962760..964631)
Genome map
AA seq 623 aa AA seqDB search
MNDTPELPQDTSAPALGAAEQPQQHAVPTLPVLADGAQTTAPLNAARDAANYVARMWSDI
RSADAAAPNDAVPGDAAAVPDDAVPVAEEAPMPSATLPADAVRGLLAGRSVLVLGLGISG
LSMARWCARCGAEVTVADTRSEPPLLARLRAELPQARFVPGAFDAALVSGRGLHAVLCSP
GLSPAEIAPVVGAANTDGVSAGGELGLYSEALAALRGACGYAPRVLAVTGTNGKTTVTAL
TGLLVERSGASVAVAGNIGPALLDTLAQHIDASTLPEVWVLELSSFQLDAPAPFEPTAAT
VLNLSQDHLDWHGDMAAYAGAKARIFGRTGLMVLNREDEAVMQMHASASAPAVSEAGPRG
KAAKPAPRDCITFGGDLPQRPGDYGIENVNGMAWLVRAQEADETRKRSTRRTAVVQAEPD
ELFIQRLIPADALRIRGRHNAVNALAALALAQAAGCALGPILYGLREYAGEPHRVELVAL
IDGVEYFDDSKGTNVGATVAAISGLGAERRVVVILGGLGKGQDFSPLAAPIARHARAVVL
IGRDAPQIRAALEATGVPLLGAGTLDEAVEIAAQRAAAGDAVLLSPACSSFDMFDNYVRR
GEVFCDIVRQRALDAGQVGEGAA
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacacgcccgaactgccccaagacacctccgcgcctgcgctgggtgcggcagag
cagccgcagcagcacgcagtgccaacgctgccggtgctggccgatggcgcgcagaccact
gcgccgctgaacgctgcacgcgatgcggcgaattacgtcgcgcgcatgtggagcgatatc
cgcagtgccgatgctgcggcgcccaacgatgcagtgccgggcgatgccgcagccgttcct
gacgatgccgtgcccgtcgctgaagaagccccgatgcccagcgcgaccctgccggccgac
gcggtgcgtggcctgctcgccggacgttcggtcctggtactgggcctggggatctccggc
ctgtcgatggcgcgttggtgcgcacgctgtggggccgaggtcaccgtggccgacacgcgg
tccgagccgccgctgctggcgcgcctgcgcgccgaactgccccaagcccggttcgtccct
ggcgccttcgatgcggcgctggtgagtggccggggcctgcatgcggtgctgtgttcgccc
ggtctcagcccagccgaaattgctcctgtagtaggagctgccaatacagatggggtaagc
gctggaggcgaattaggcttgtattctgaggcgctggctgcgctgcgcggcgcctgtggc
tacgcgccacgtgtgctggctgtcacggggaccaacggcaagaccacggtcaccgcgctg
accgggctgcttgtggagcgcagtggtgccagcgtggcggtggccggcaacattggcccg
gccctgctcgatacgctggcgcagcacatcgacgccagcacgttgcccgaggtctgggtg
ctcgagctctccagcttccagcttgatgcacctgcgccgtttgagcccacggccgccacg
gtgctcaacctcagccaggaccacctcgactggcacggtgacatggcggcttacgccggc
gccaaggcgcgcatctttggccgcaccggtctcatggtgctcaaccgcgaagacgaagcc
gtgatgcagatgcacgcatcggccagcgcaccggcggtgtccgaagccggcccacgcggc
aaggcggccaaacccgcgccgcgcgactgcatcacctttggcggcgacctgccccagcgc
cccggcgactacggcatcgaaaacgtcaacggtatggcctggctggtgcgcgcccaggag
gccgatgagacgcgcaagcgcagcacacgccgtactgccgtagtgcaggccgagcccgac
gaattgttcatccaacgcttgattcctgcggacgctctgcgcattcgtggccggcacaac
gcagtgaacgcgctggcggcgctggccctggcgcaagcagcgggttgcgcgctcggcccc
atcctctacggcctgcgcgaatacgccggcgagccgcaccgggtggagttggtggcgctg
atcgatggggtcgaatactttgatgacagcaagggcaccaacgtgggcgccaccgtggcg
gccatttcgggcctgggcgctgagcgccgcgtcgtggtgattctgggtggcctgggcaag
gggcaggatttttctccgctcgctgcaccgattgcacgccatgcccgggcggtggtgctg
atcgggcgcgacgcgccgcagatccgcgcggcgctggaggccactggcgtcccgttgctg
ggtgccggtacgctggacgaagctgtagaaatcgctgcgcaacgcgccgcagcgggcgac
gccgtgctgctctcgcccgcctgctccagcttcgacatgttcgacaactatgtccggcgc
ggagaggtgttctgcgacatcgtgcgccagcgcgcgctggacgccggccaggtcggggag
ggcgctgcatga

DBGET integrated database retrieval system