KEGG   Simplicispira suum: C6571_05785Help
Entry
C6571_05785       CDS       T05361                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
simp  Simplicispira suum
Pathway
simp00620  Pyruvate metabolism
simp00630  Glyoxylate and dicarboxylate metabolism
simp01100  Metabolic pathways
simp01110  Biosynthesis of secondary metabolites
simp01120  Microbial metabolism in diverse environments
simp01200  Carbon metabolism
Module
simp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:simp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C6571_05785
   00630 Glyoxylate and dicarboxylate metabolism
    C6571_05785
Enzymes [BR:simp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     C6571_05785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AVO40864
UniProt: A0A2S0MY98
Position
1227959..1230166
Genome map
AA seq 735 aa AA seqDB search
MTDRTSLHGLQVATTLLRFVDEQVLPGTGLESAAFWKGFDAIVSDLAPRNIALLAERERL
QAELDTWHKANPGPIMDMLAYRTFLEQIGYLVPQPAEVKATTANVDDELALQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDAIPETDGCEKGPGYNEKRGAKVIAFARRVLDESA
PLAQGSHADASAYRVENGALVVALQGGASTGLKNPAQFMGYQGDAASPSSVLLQHNGLHL
DIRIDRSTPIGKTDAAGVSDLVLEAALSTILDLEDSVAAVDADDKVLGYSNWLGILKATL
TEEVAKGGKTFTRGLNPDRVYTAPAGRGEVRLHGRSLMFLRNVGHLMTNPAILWTDKQGQ
VREIPEGILDAVVTTTIALHDLQGHGKDGIRNSRKGSVYIVKPKMHGPAEVAFASELFGR
VEQLLGLPENTVKLGIMDEERRTSVNLKACIAAAASRVAFINTGFLDRTGDEMHSAMYAG
PMIRKGDMKTSAWIQAYEKNNVLVGLSCGLRGKAQIGKGMWAMPDLMAAMLEQKIAHPRA
GANTAWVPSPTGATLHALHYHQVLVSDVQKEMEKIDANAERDNLLTGLLTIPVSANPNWS
DEEIQQELDNNAQGILGYVVRWVDQGVGCSKVPDIHNVGLMEDRATLRISSQHMANWLLH
GVVSEGRIQATFQRMAAVVDQQNGSDPLYQRMAGNFDTSMAYQAACELVFKGKEQPSGYT
EPLLHAWRLKVKAAA
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcacctctctccacggcctgcaagtggccaccacgctcctgcgcttcgtt
gacgaacaggtgcttcctggcaccggcctcgaaagcgccgccttctggaaagggtttgat
gccatcgtctccgacctggccccgcgcaatattgccttgctggccgagcgcgagcgcctt
caggccgagctggacacctggcacaaggccaacccaggccccatcatggacatgctggcc
taccgcacgtttctggagcaaattggctacctcgtgccccagccggctgaggtcaaggcc
accaccgccaacgtggacgacgagctggcgctgcaagccggcccgcaactcgtggtgccc
attctcaacgcccgctacgcgctcaatgccgccaacgcgcgctggggcagcctgtacgac
gcgctctatggcaccgacgcgatccccgaaaccgatggctgcgagaaaggccctggttac
aacgagaagcgcggcgccaaagtgatcgcctttgcccgccgcgtgctcgacgaatcggcc
ccgctggcccagggttcgcacgccgatgccagcgcctaccgcgtcgagaacggcgcgctg
gtcgtcgcactgcaaggcggggccagcacgggcctgaaaaacccggcccagttcatgggc
taccagggcgatgcggccagcccctcgtccgtgctgctgcagcacaacggcctgcatctc
gatatccgcatcgatcgcagcacccccatcggcaagaccgatgccgccggcgtgagcgac
ctggtgctcgaagccgcgctttcgaccattctcgatctggaagactcggtggccgctgtg
gacgccgacgacaaggtactgggctacagcaactggctgggcatcctcaaagccacgctg
accgaagaagtcgccaagggcggaaagaccttcacgcgcggcctcaatcctgaccgcgtc
tacacggcgccggccggcaggggcgaagtgcgcctgcacggccgctcactgatgttcctg
cgcaatgttggtcatctgatgacgaatccggccatcctgtggaccgacaagcaaggccag
gtgcgtgagattcccgaaggcatcttggacgctgtggtcaccaccaccatcgccctgcac
gatctgcaggggcacggaaaggacggcattcgcaactcgcgcaagggcagcgtctacatc
gtcaagcccaagatgcacggccccgccgaagtcgcttttgccagcgaactgttcggccgc
gtcgagcaactgctgggcctgccggagaacaccgtcaagctgggcatcatggacgaagag
cgccgcaccagcgtcaacctcaaggcctgcatcgccgcagccgccagccgggtggccttc
atcaacaccggcttcctggaccgcactggcgacgagatgcacagcgccatgtacgccggc
cccatgatccgcaagggcgacatgaagaccagcgcctggatccaggcctacgagaagaac
aacgtgctcgtcggcctctcgtgcgggctgcgcggcaaggcgcagatcggcaagggcatg
tgggccatgcccgacctgatggcggccatgctggagcaaaagatcgcccaccccagggcc
ggcgccaacaccgcctgggtgcccagccccacgggcgccacgctgcacgccctgcactac
caccaggtgctggtcagcgacgtgcaaaaggagatggaaaagatcgacgccaacgccgag
cgcgacaacctgctcaccggcctcttgaccattcccgtcagcgccaatccgaactggagc
gacgaagaaatccagcaggaactggacaacaacgcacagggcatcctgggctatgtggtg
cgctgggtggaccagggcgtgggctgctccaaggtgcccgacatccacaacgtggggctg
atggaagaccgtgccacgctgcgcatcagcagccagcacatggccaattggctcttgcat
ggcgtggtgagcgaaggccgcatccaggccaccttccagcgcatggctgcggtggtcgac
cagcagaacggcagcgacccgctgtaccagcgcatggccggcaacttcgacaccagcatg
gcctaccaggctgcctgcgagctggtcttcaaaggcaaggagcagcccagcggctacacc
gagccgctgctgcacgcctggcggctcaaggtgaaggcggcggcctga

DBGET integrated database retrieval system