KEGG   Simplicispira suum: C6571_09070Help
Entry
C6571_09070       CDS       T05361                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
simp  Simplicispira suum
Pathway
simp00270  Cysteine and methionine metabolism
simp00480  Glutathione metabolism
simp01100  Metabolic pathways
Module
simp_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:simp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    C6571_09070
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C6571_09070
Enzymes [BR:simp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     C6571_09070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AVO41426
UniProt: A0A2S0MZW8
Position
1953568..1954512
Genome map
AA seq 314 aa AA seqDB search
MHYLFVADPLEAFNPKKDTTFAMMREAVRRGHTLAACEPADLHWELGGKVQARVRQITLT
GRAADWFEETGTDVATLADFGVVLMRKDPPFDSEYFYSTHLLEQAEREGARVYNKPRALR
DHPEKLAILEFPEFIGPTLVTRNAADIRKFHSEHHDIILKPLDGMGGMGIFRVGPDAMNL
GSISETLNRGGAQSVMVQKFLPEIAEGDKRILIIDGEPVPFCLARIPQGSEVRGNLAAGG
KGVARPLSQRDWEIGKALGPILAGRGLLLTGIDVIGDCVTEINVTSPTCFQEIQQQTGCD
VASIYQDALDRLLG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcactatttgtttgtcgccgatccgctcgaagccttcaaccccaagaaggacaccacc
ttcgccatgatgcgcgaagcggtgcgacgcgggcataccctagcggcttgcgagcccgca
gatttgcactgggagttgggcggaaaagtgcaggcacgagtccgccaaatcaccctgacg
ggccgcgctgcagactggtttgaggaaaccggaacggacgttgccacgttggcggatttt
ggggtggtcttgatgcgaaaagatccgccatttgacagcgagtacttctattccacccac
cttctcgagcaggccgagcgggagggcgcgcgcgtctacaacaagccccgtgcgttgcgc
gatcacccggaaaaactggccatccttgagttcccggaattcattggcccgacgctggtg
acgcgcaatgcggcagatatccggaaatttcattcggagcaccacgacatcattcttaag
cccttggacggaatggggggcatgggaatctttcgcgttggtcccgatgcgatgaatttg
ggcagcatttccgaaacgctcaatcgcggaggggcccagagtgtgatggtgcaaaaattt
cttcctgagattgcagagggcgacaagcgcatcttgatcattgacggcgagcctgtgccg
ttctgcctggcgcgcattccccaaggcagcgaggttcgcggcaacttggctgctggaggc
aagggtgtcgcccgcccactaagccagcgcgactgggagataggcaaggcgctagggccg
atccttgctggacgtggactcttgctgaccggtatcgatgtcattggagactgcgtcacc
gaaatcaatgtcaccagccccacctgctttcaggaaattcagcagcaaacgggttgtgac
gtggcttccatttaccaggacgcactcgatcgcctgttgggctga

DBGET integrated database retrieval system