KEGG   Simplicispira suum: C6571_13625Help
Entry
C6571_13625       CDS       T05361                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K18365  4-hydroxy-2-oxovalerate/4-hydroxy-2-oxohexanoate aldolase [EC:4.1.3.39 4.1.3.43]
Organism
simp  Simplicispira suum
Pathway
simp00362  Benzoate degradation
simp00621  Dioxin degradation
simp00622  Xylene degradation
simp01100  Metabolic pathways
simp01120  Microbial metabolism in diverse environments
simp01220  Degradation of aromatic compounds
Module
simp_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:simp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C6571_13625 (dmpG)
   00622 Xylene degradation
    C6571_13625 (dmpG)
   00621 Dioxin degradation
    C6571_13625 (dmpG)
Enzymes [BR:simp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     C6571_13625 (dmpG)
    4.1.3.43  4-hydroxy-2-oxohexanoate aldolase
     C6571_13625 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm DUF4410
Motif
Other DBs
NCBI-ProteinID: AVO42186
UniProt: A0A2S0N240
Position
2931284..2932321
Genome map
AA seq 345 aa AA seqDB search
MSTLKGKKVRLHDMTLRDGMHPKRHLMTLEQMTSVATALDGAGMPLIEVTHGDGLGGSSV
NYGFPAHTDEEYLGAVVPLMQHAKVSALLIPGIGTVDHLRMAHDLGVHTIRVATHCTEAD
VSEQHIGLARKLGMDTVGFLMMSHMNSAEGLVTQARLMEGYGANCIYITDSAGHMLPHDV
KEKLGAVRQALKPETELGFHGHHNLAMGVANSLAAIEVGCSRIDAAAAGLGAGAGNTPME
VLVAVCDLMGIDTGVDVFKIQDVAEDLVVPIMDFPIRIDRDALTLGYAGVYGSFLLFAKR
ASQKYGVPAREILVEMGRRGMVGGQEDMIEDTALTLAKARGLQVA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcacactcaaaggcaaaaaagttcgtctgcacgatatgacgctgcgcgacggcatg
caccccaagcgccacctgatgaccttggagcagatgacctccgtcgccactgcactggac
ggggctggcatgccgctgatcgaggtgacgcacggcgacggtctgggcggcagctcggtc
aactacggttttccggcccacaccgacgaggaatacctgggtgcggtggttccgctaatg
cagcatgccaaagtctcggctctgctcattcccggtatcggtaccgtggaccacctgcgc
atggcgcacgatctgggtgtgcacaccattcgcgtcgccacgcactgcaccgaggccgac
gtgagcgagcagcacattggcctggcgcgcaagctcggcatggacaccgtgggctttctg
atgatgagccacatgaacagtgccgaaggcctggtcacgcaggccaggctgatggagggc
tacggcgccaactgcatctacatcaccgactcggccggtcacatgttgccgcacgacgtg
aaagaaaaactcggtgcggtgcgccaggccttgaagcccgagaccgaactcggctttcac
ggccaccacaacctcgcgatgggcgttgccaacagcctggccgccattgaagtgggctgc
agccgcatcgatgcggccgccgccggcctgggtgcgggtgcgggcaatacccccatggaa
gtgctggtggcggtatgcgatctgatgggtatagacaccggtgtcgatgttttcaagatc
caggacgttgccgaagacttggttgtgcccatcatggattttcccatccgaatcgatcgt
gacgcacttacgctgggctatgccggcgtgtacggctcctttctgttgttcgccaagcgc
gcaagccagaagtacggtgttccggcgcgtgaaatccttgtcgaaatgggccgccgtggc
atggtcggcggccaggaagacatgatcgaagacaccgcgctcacgctggccaaggcgcgc
ggtttgcaagtggcttga

DBGET integrated database retrieval system