KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_1198Help
Entry
YN1551_1198       CDS       T00902                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
sin00260  Glycine, serine and threonine metabolism
sin00750  Vitamin B6 metabolism
sin01100  Metabolic pathways
sin01110  Biosynthesis of secondary metabolites
sin01120  Microbial metabolism in diverse environments
sin01230  Biosynthesis of amino acids
Module
sin_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YN1551_1198
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YN1551_1198
Enzymes [BR:sin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YN1551_1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Zn-ribbon_8 DFP
Motif
Other DBs
NCBI-ProteinID: ACP48304
UniProt: C3NGP4
Position
1065242..1066267
Genome map
AA seq 341 aa AA seqDB search
MVKEVCMKCRKERESIYEIKCNKCGGPFEILIDFEFDKNSERGFPYSEKIFPYIKHFISL
GEGRTPLIKKGNIWFKLDFLNPSGSYKDRGAVTLVSYLAEKGVKQISEDSSGNAGSAIAA
YSAAAGIEAYIFVPETAKGGKLKQIESYGAHVVRVRGSREDVAKAAENSGYYYASHVLQP
QFRDGIRTLAYEIVKDLDWKIPNYVFIPVSAGTLLLGVYKGFKHLLDSGVISEMPKIVAV
QTEQVMPLCAKFKKISYTPPDKVTSIADALVSTRPFLLDYMVKASSECIVVSDNEIVEAW
KELAKMGLLVEYSSATVFAAYKKYSVNDAVLVLTGSGLKVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaggtttgtatgaaatgcagaaaggaaagggaaagtatatacgagattaag
tgtaacaaatgcggaggaccattcgagatcctgatagattttgaatttgataagaattct
gagagaggttttccctatagtgaaaagattttcccttacatcaaacatttcatatcccta
ggagagggaagaactccattaattaaaaaggggaacatatggtttaaactcgacttctta
aatccatcaggatcatacaaggatagaggagcagtgactctggtctcttatcttgcggaa
aaaggtgtaaaacaaattagtgaagactcttctggaaatgcaggatcagcaatagctgcg
tattctgcagctgctggtattgaggcatacattttcgttcctgaaacggcaaaaggagga
aaacttaagcaaatagaatcctacggtgctcacgttgttagagtaagggggagtagagaa
gatgtagcaaaagctgcagagaattctggttactattacgcatcacatgttttacaacct
caatttagagatgggattagaactctggcatatgaaattgtaaaggatttagattggaaa
attcctaattatgttttcattccagtatcagcaggaactttacttttaggtgtttataag
gggttcaagcacttgctagattctggtgtcatatcggaaatgcctaaaatcgtagcagtc
caaacagagcaagttatgccactttgtgctaaattcaaaaagatttcttacacaccacca
gacaaggttacctccattgcagacgctttagtatcaactagaccatttctactagattat
atggtaaaggcttctagtgaatgcatagttgtaagcgataatgaaatagtagaagcttgg
aaagaattggctaaaatgggactgctggtagaatatagttctgctactgtatttgctgct
tataagaaatacagtgttaacgatgcagtattagttttaaccggtagcggattaaaggta
ttatga

DBGET integrated database retrieval system