KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_3085Help
Entry
YN1551_3085       CDS       T00902                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
sin00010  Glycolysis / Gluconeogenesis
sin00051  Fructose and mannose metabolism
sin00562  Inositol phosphate metabolism
sin01100  Metabolic pathways
sin01110  Biosynthesis of secondary metabolites
sin01120  Microbial metabolism in diverse environments
sin01130  Biosynthesis of antibiotics
sin01200  Carbon metabolism
sin01230  Biosynthesis of amino acids
Module
sin_M00002  Glycolysis, core module involving three-carbon compounds
sin_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YN1551_3085
   00051 Fructose and mannose metabolism
    YN1551_3085
   00562 Inositol phosphate metabolism
    YN1551_3085
Enzymes [BR:sin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YN1551_3085
Exosome [BR:sin04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YN1551_3085
  Exosomal proteins of bladder cancer cells
   YN1551_3085
  Exosomal proteins of melanoma cells
   YN1551_3085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM NMO ThiG FMN_dh His_biosynth DUF561 G3P_antiterm IGPS DHO_dh Glu_synthase IMPDH Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ACP49970
UniProt: C3NFN6
Position
complement(2733661..2734344)
Genome map
AA seq 227 aa AA seqDB search
MKPPIIVINFKAYENSFGNKAIELGKKIEKISKEHSVEIILSVPATMIYRMVQEVDLPIY
AEHVDPVPLGAYTGAVLPEMIKDADAKGTLINHSERRLRADEIDDVLKRTRKLGLSSILC
VDRYELVYPFSLLRPDAILIEPPELIGTGISVSKAKPEVITKAVDEIRKSEGIYLIAGAG
ITTGEDVYKALKLGAHGIGVASAVMKAKEPEKVVEDFITSALKAISS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccccctattattgtgataaactttaaggcctacgaaaactcctttggtaataag
gcaattgagttaggtaaaaagatagaaaaaataagtaaggagcattcagttgaaataata
ttatcagtaccagctactatgatctacagaatggtccaagaggtagatttaccaatttat
gctgaacatgtagatccagttcctctaggcgcttatacgggagccgtattaccagaaatg
ataaaagatgcagatgctaaagggacattgataaatcacagtgagagacgtctaagggct
gatgaaatagatgatgtattaaaaagaactaggaaattaggtttgagtagtatactatgc
gttgacagatatgagttagtctatccctttagtttactaaggcctgatgcaattttgata
gagcctccagaattgataggaaccggtatctcagtgtctaaagccaaacccgaggtaata
acaaaagccgtggatgagataagaaagtctgaggggatctatttaatagcgggtgctgga
attacaaccggtgaggacgtttataaagcgttaaagctcggagctcatggaataggtgta
gcaagtgcagtcatgaaggctaaagaacctgagaaagttgttgaagattttatcacaagt
gcattgaaggctatctcttcttag

DBGET integrated database retrieval system