KEGG   Sphingobium indicum: SIDU_00295Help
Entry
SIDU_00295        CDS       T04604                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
sinb  Sphingobium indicum
Pathway
sinb00670  One carbon pool by folate
sinb01100  Metabolic pathways
sinb01120  Microbial metabolism in diverse environments
sinb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SIDU_00295
Enzymes [BR:sinb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     SIDU_00295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: APL93097
UniProt: A0A1L5BJZ5
Position
55032..55961
Genome map
AA seq 309 aa AA seqDB search
MTLGFPSVEAAQAWQAPLYADLAGDVNVSFEFFPPKSEKMEEQLWSAIQTLTPLGPKFVS
VTYGAGGSTRERTHNTVARIAKETPLSAAAHLTCVAASRAEIDEVADAYWEAGVRHIVAL
RGDPPEMGAKFEPHPEGYKGAAELVEGLRKRHLFEISVAAYPETHPDAQSAQSDIDNLKR
KLDAGATRAITQFFFEPDTFFRFRDAVAAAGIDADIIPGIMPVSNFAAVQRMSAMCNTDV
PGWMGKLFEGLDDHAAARQLVSATLAAELCRKLYAGGVRDFHFYTLNRAELSYAICHLLG
LRPVATNAV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacccttggtttcccctccgtcgaagcggcccaggcctggcaggcgccgctctacgcc
gatctggcgggcgacgtgaatgtgagcttcgaattcttcccccccaagtcggagaagatg
gaggagcagctatggtccgccatccagacgctgacgccgctcggcccgaaattcgtgtcc
gtcacctatggcgcgggcgggtcgacgcgggagcggacgcacaacacggtggcccggatc
gcgaaggaaacgcccctgtcggcggcggcgcacctgacctgcgtggcggcgagccgagct
gaaatcgacgaggtggccgacgcctattgggaagcgggcgtgcggcatatcgtggccctg
cgcggcgatccgccggaaatgggcgcgaagttcgaaccgcatccggaaggctacaagggc
gcggccgaactggtcgagggattgcgcaagcgtcacctgttcgagatttccgtggccgcc
tatcccgaaacccatcccgacgcgcagagcgcgcagagcgacatcgacaatttgaagcgc
aagctggacgcgggcgcgacgcgggcgatcacccaattcttcttcgagccggacaccttc
ttccgcttccgcgacgcggttgcggcggcggggatcgacgcggacatcatccccggcatc
atgccggtcagcaatttcgcggcggtccagcgcatgtcggccatgtgcaacaccgacgtg
ccgggctggatgggcaagctgttcgaggggctggacgaccatgcggcggcccggcaactc
gtgtccgcgacgctggcggcggaactgtgccgcaaactctatgcgggcggggtgcgcgac
tttcatttctacacgctcaaccgggcggaactgagctatgcgatctgccatctgctgggg
ttgcggccggtggcgacaaatgcggtttga

DBGET integrated database retrieval system