KEGG   Sphingobium indicum: SIDU_00975Help
Entry
SIDU_00975        CDS       T04604                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
sinb  Sphingobium indicum
Pathway
sinb00780  Biotin metabolism
sinb01100  Metabolic pathways
Module
sinb_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SIDU_00975
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sinb01007]
    SIDU_00975
Enzymes [BR:sinb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     SIDU_00975
Amino acid related enzymes [BR:sinb01007]
 Aminotransferase (transaminase)
  Class II
   SIDU_00975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: APL93214
UniProt: A0A1L5BK40
Position
complement(195428..196645)
Genome map
AA seq 405 aa AA seqDB search
MTTQTRDLFSKFDPLIAEREALLATGVRDPFAIVMDEVKSPTQAVIKGKDTILLGTYNYM
GMTFDPDVIAAGKKALDDFGAGTTGSRLLNGTYQGHKEVEEALKDFYGTSGAMVFSTGYQ
ANLGMISTLAGRGDYVVLDADSHASIYDGCFLGDAEIVRFRHNSVEDLDKRLGRLPADAL
KLVVLEGVYSMLGDVAPLPDMVAAVRKHPNCMILVDEAHGMGFFGPNGRGVYEEQGVEKD
VDFVVGTFSKSVGTVGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIHKLMHA
GEKRAHLWKNSQRLHKGLTDLGFRLGTETPQSAIIAVILTDQTQAVAMWQTLLELGLYVN
MARPPATPAGTFLLRCSLCAEHSDEQVGQIIAMFEAAGRATGAIG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcaaacccgcgacctcttctccaaattcgaccccctgatcgccgagcgcgag
gcgctgttggcgacaggcgtgcgcgatcccttcgccatcgtcatggacgaggtgaagtcc
cccacccaggccgtcatcaagggcaaggacacgatcctgctcggcacctacaactatatg
ggcatgaccttcgacccggacgtcatcgccgcgggcaagaaggcgctggacgatttcggc
gcgggcaccaccggcagccgcctgctgaacggcacctatcaggggcacaaggaagtcgag
gaagcgctcaaggacttctacggcaccagcggcgcgatggtcttctccaccggctatcag
gccaatctgggcatgatttccaccctggcgggccggggcgattatgtcgtgctggacgcg
gacagtcatgcctccatctatgacggctgcttcctgggcgatgcggagatcgtccgtttc
cgccacaacagcgtggaggatctggacaagcgcctgggccgcctgcccgccgacgcgctg
aagctggtggtgctggaaggcgtctattcgatgctgggcgacgtcgcgccgctgccggac
atggtggccgccgtgcgcaagcatcccaattgcatgattctggtggacgaggcgcatggc
atgggctttttcggtcccaatggccgcggcgtctatgaggagcagggcgtcgagaaggac
gtcgatttcgtcgtcggcaccttctccaagtcggtcggcacggtcggcggcttctgcgtg
tccaaccacccgaagttcgaggtgttgcgcctcgtctgccgtccctatgtcttcaccgcg
tcgctgccgcccagcgtcgtcgccaccgccgcgacgtcgatccacaagctgatgcatgcg
ggcgagaagcgcgcccatctgtggaagaacagccagcggctgcacaagggcctcaccgac
ctcggcttcaggctgggcacggaaacgccgcagtccgcgatcatcgccgttatcctgacc
gaccagacccaggcggtggccatgtggcagacgctgctggagctggggctctacgtcaac
atggcgcgccccccggcgacccccgccggaaccttcctgctgcgctgttcgctttgcgcg
gaacatagcgatgaacaggtcggccagatcatcgccatgttcgaggccgcgggcagggcc
acgggcgcgatcggctga

DBGET integrated database retrieval system