KEGG   Sphingobium indicum: SIDU_04200Help
Entry
SIDU_04200        CDS       T04604                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
sinb  Sphingobium indicum
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SIDU_04200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: APL93777
UniProt: A0A1L5BLW0
Position
865647..866045
Genome map
AA seq 132 aa AA seqDB search
MNALFPFHATTRDINVHVAVTFLPEQSEPDRGRWFWAYHIRIENDGDQPVQLLTRHWIIT
DGRGAQHRVDGDGVVGEQPVVQPGKSYDYVSGCPLNTPTGSMKGHYHMIGASGETFDIAI
PHFALIAPAVAE
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcacttttccccttccacgcgacgacgcgcgacatcaacgtgcacgtcgccgtc
accttcctgcccgaacagtcggaaccggaccggggccgatggttctgggcctatcatatc
cgcatagagaatgacggggatcagccggtgcaacttctcacccggcactggatcatcacc
gacgggcggggcgcgcagcatcgggtcgacggagacggggtcgtgggggaacagccggtg
gtgcagccgggcaagagctatgactatgtgtccggctgcccgctcaacacgccgaccggc
tccatgaagggccattatcacatgatcggcgccagcggcgagacgttcgacatcgccatc
ccccacttcgcgctgatcgcgcccgcggtggccgaatga

DBGET integrated database retrieval system