KEGG   Sphingobium indicum: SIDU_06315Help
Entry
SIDU_06315        CDS       T04604                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sinb  Sphingobium indicum
Pathway
sinb00450  Selenocompound metabolism
sinb00970  Aminoacyl-tRNA biosynthesis
sinb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SIDU_06315
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SIDU_06315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sinb01007]
    SIDU_06315
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sinb03016]
    SIDU_06315
Enzymes [BR:sinb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SIDU_06315
Amino acid related enzymes [BR:sinb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SIDU_06315
Transfer RNA biogenesis [BR:sinb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SIDU_06315
 Prokaryotic type
   Other AARSs
    SIDU_06315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: APL94151
UniProt: A0A1L5BMM6
Position
complement(1332324..1333886)
Genome map
AA seq 520 aa AA seqDB search
MSKPYTITTAISYPNGRPHIGHAYEVIATDAIARFQRMMGRDVFFQTGTDEHGLKMAQTA
RSRDMEPRALADEMSGFFKAMNDGLNISYDRFIRTSEPDHHRASQAIWQAMEANGDLYLG
RYEGWYSVRDEAFYDEKELTEGEGGQKLSPQGTPVEWTVEESWFFRLSAYQQKLLDLYAN
QPDFIQPDSRRNEIMRFVEGGLSDLSVSRTSFDWGVKVPGSDGHVMYVWVDALTNYITGC
GYPDDAERMARYWSEGGDITHIIGKDIVRFHTVYWPAFLMSAKLSLPKQVFGHGFLLNRG
EKMSKSLGNVADPMELAERFGVDQLRYFLLSEVTFGNDGSYSAEAIVARSNSDLANSFGN
LAQRTLSFIAKNLEGRLPETAAQDVDRDLLATVGEAARTFQAAMADLAPSTAIEAWMRAV
FACNAYIDAQAPWTLRKTDPARMEAVLATLYEAIADLAIVIQPIIPASAAALLEQMGIAE
DGRSYAAIGSDWYARLRASGFTLNAPKPLFPRLELPVEEA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccctataccatcacgaccgccatcagctaccccaatggccgcccgcatatc
ggccacgcctatgaagtgatcgccaccgacgcgatcgcccgtttccagcgaatgatgggc
cgcgacgtcttcttccagaccggcacggacgaacatgggctgaaaatggcccagaccgcg
cgcagccgggacatggaaccgcgcgcgctcgccgatgaaatgtctggatttttcaaggcc
atgaacgatggtttgaatatcagctatgatcgttttatccgcaccagcgagccggatcac
catcgcgccagccaggcgatctggcaggcgatggaggccaatggcgacctctatctcggc
cgttatgaaggctggtattccgtccgggacgaggccttttacgacgaaaaggaactgacg
gagggagagggcggccagaagctctcgccccagggcacgccggtggaatggacggtggag
gaaagctggttcttccgcctgtccgcctatcagcagaagctgctggacctctacgctaac
cagccggacttcatccagcccgacagccgccgcaatgagatcatgcgcttcgtcgaggga
ggactgtccgacctcagcgtgtcacgcaccagcttcgactggggcgtgaaggtgccgggc
agcgacggccatgtcatgtatgtgtgggtggacgcgctcaccaactacatcactggctgc
ggctatcccgacgatgccgaacgcatggcccgatactggtcggaagggggcgacatcacg
cacatcatcggcaaggacatcgtgcgttttcataccgtttactggccggccttcctgatg
agcgcgaagctgtccctgcccaaacaggtcttcggccacggcttcctcctcaaccggggg
gaaaagatgtcgaagtcgctcggcaatgtggccgatccgatggaactggcggagcgtttc
ggcgtggaccagcttcgctatttcctgctgtcggaagtcaccttcggcaatgacggcagc
tacagcgcggaggcgatcgtcgcccgttcgaacagcgacctcgccaacagcttcggcaat
ctggcccaacggacgctgagtttcatcgccaagaatctggaaggccgcctccctgagacc
gcggcgcaggacgtcgaccgcgatcttcttgcgaccgtcggcgaagcggcccggactttc
caggcggccatggccgacctggcgccatcgacagccatcgaagcatggatgcgggccgtc
ttcgcctgcaacgcctatatcgacgcgcaggcgccctggacgctccgcaagaccgatccc
gcccggatggaggccgtgctcgctaccctctatgaggccatcgccgatcttgccatcgtc
atccagccgatcatcccggcaagcgccgctgccctgctggaacagatggggatagccgag
gatggccggagctatgccgccatcggtagcgactggtatgcgcggcttcgcgcttccggc
ttcacccttaacgcgcccaagccgcttttcccgcgcctcgaactgcccgtcgaagaggcg
taa

DBGET integrated database retrieval system