KEGG   Sphingobium indicum: SIDU_11965Help
Entry
SIDU_11965        CDS       T04604                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
sinb  Sphingobium indicum
Pathway
sinb00010  Glycolysis / Gluconeogenesis
sinb00071  Fatty acid degradation
sinb00350  Tyrosine metabolism
sinb00625  Chloroalkane and chloroalkene degradation
sinb00626  Naphthalene degradation
sinb00680  Methane metabolism
sinb01100  Metabolic pathways
sinb01110  Biosynthesis of secondary metabolites
sinb01120  Microbial metabolism in diverse environments
sinb01130  Biosynthesis of antibiotics
sinb01200  Carbon metabolism
sinb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SIDU_11965
  09102 Energy metabolism
   00680 Methane metabolism
    SIDU_11965
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SIDU_11965
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SIDU_11965
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SIDU_11965
   00626 Naphthalene degradation
    SIDU_11965
Enzymes [BR:sinb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SIDU_11965
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     SIDU_11965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: APL95168
UniProt: A0A1L5BQT0
Position
2519559..2520671
Genome map
AA seq 370 aa AA seqDB search
MKTRAAVAFEAKKPLEIVEVDLEGPKAGEVLVEIMATGICHTDAYTLDGFDSEGIFPSIL
GHEGAGIVREVGAGVTSVKPGDHVIPLYTPECRQCKSCLSGKTNLCTAIRATQGKGLMPD
GTTRFSYKGQSIFHYMGCSTFSNFTVLPEIAVAKIREDAPFQSSCYVGCGVTTGVGAVVN
TAKVQAGENVVVFGLGGIGLNVIQGAKMVGADRIVGIDINPDREEWGRRFGMTHFINSRG
LSREETVARILEVTDGGADYSFDATGNTEVMRTALECCHRGWGESIIIGVAEAGKEISTR
PFQLVTGRVWKGTAFGGAKGRTDVPRIVDWYMNGKIEIDPMITHVLTLEEINKGFDLMHA
GESIRSVVLF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaagacccgcgccgccgtcgccttcgaggcgaagaagcccctggagatcgtcgaagtc
gatctggaaggcccgaaggcgggcgaggttctggtggagatcatggcgacgggcatctgc
cacaccgacgcctatacgctggacggcttcgacagcgagggcatcttcccctcgatcctg
ggccatgagggcgcaggcatcgtgcgggaggtcggcgcgggcgtcacctcggtgaagccc
ggcgaccatgtgatcccgctctacacgcccgaatgccgccagtgcaaaagctgcctgtcg
ggcaagacgaacctgtgcaccgcgatccgcgccacccagggcaaggggctgatgcccgac
ggcacgacccgtttcagctacaagggccagtcgatcttccactatatgggctgctccacc
ttctccaacttcaccgtcctgccggagatcgcggtggccaagatccgcgaggacgcgccc
ttccagtcgagctgctatgtgggctgcggcgtcaccaccggcgtcggcgccgtcgtcaac
acggccaaggtgcaggcgggcgagaatgtcgtggtcttcggcctgggcggcatcggcctc
aacgtcatccagggcgcgaagatggtcggcgcggacaggatcgtcggcatcgacatcaac
cccgaccgggaggagtggggccgcaggttcggcatgactcatttcatcaacagcaggggt
ctgtcgcgggaggagaccgttgccaggatcctggaggtgacggacggcggcgccgactac
agcttcgacgcgaccggcaatacggaggtgatgcgcaccgcgctcgaatgctgtcatcgc
ggctggggggaaagcatcatcatcggcgtggccgaagcggggaaggaaatcagcacccgc
ccgttccagctcgtcaccggccgcgtctggaaggggacagcctttggcggcgcgaagggc
cgcaccgacgttcccaggatcgtcgactggtacatgaacggcaagatcgagatcgatccg
atgatcacccatgtgctgacgctggaggagatcaacaagggcttcgacctgatgcatgcg
ggggaaagcatccgcagcgtcgtgctgttctga

DBGET integrated database retrieval system