KEGG   Sphingobium indicum: SIDU_15070Help
Entry
SIDU_15070        CDS       T04604                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sinb  Sphingobium indicum
Pathway
sinb00071  Fatty acid degradation
sinb00072  Synthesis and degradation of ketone bodies
sinb00280  Valine, leucine and isoleucine degradation
sinb00310  Lysine degradation
sinb00362  Benzoate degradation
sinb00380  Tryptophan metabolism
sinb00620  Pyruvate metabolism
sinb00630  Glyoxylate and dicarboxylate metabolism
sinb00640  Propanoate metabolism
sinb00650  Butanoate metabolism
sinb00900  Terpenoid backbone biosynthesis
sinb01100  Metabolic pathways
sinb01110  Biosynthesis of secondary metabolites
sinb01120  Microbial metabolism in diverse environments
sinb01130  Biosynthesis of antibiotics
sinb01200  Carbon metabolism
sinb01212  Fatty acid metabolism
sinb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SIDU_15070
   00630 Glyoxylate and dicarboxylate metabolism
    SIDU_15070
   00640 Propanoate metabolism
    SIDU_15070
   00650 Butanoate metabolism
    SIDU_15070
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SIDU_15070
   00072 Synthesis and degradation of ketone bodies
    SIDU_15070
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SIDU_15070
   00310 Lysine degradation
    SIDU_15070
   00380 Tryptophan metabolism
    SIDU_15070
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SIDU_15070
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SIDU_15070
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SIDU_15070
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sinb04147]
    SIDU_15070
Enzymes [BR:sinb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SIDU_15070
Exosome [BR:sinb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SIDU_15070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APL95727
UniProt: A0A1L5BSF8
Position
complement(3161457..3162632)
Genome map
AA seq 391 aa AA seqDB search
MRDAVIVSTARTPIGKAYRGAFNNLPAPTLASHAISAAVSRAKLDPADIDDCIMGSALQQ
GSQATIGRNAALRAGLPVTVAGMSIDRQCASGLMAIATAAKQIIVDRMDIVVAGGVESIS
LVQTDALRVDEDPELVALHGDAYIAMIDTAENVARRYGVSRAAQDEYSLQSQQRTAAAQA
AGLFQDEIVPVTATMIVTDKATGEKTSRIVTLTQDEGNRADTTLEGLAGLKPVRGPDAFI
TAGNASQLSDGASASVLMERQVAEERGLQPLGRYLGMAVAGTEPDEMGIGPVFAIPKLLD
RFGLGIGDIGLWELNEAFASQVLYCRDALGLPNDRLNVNGGGISIGHPYGMTGARLVGHA
LLEGRRRGEKYVVITMCVGGGMGAAGLFEVL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacgcagtaatcgtctccaccgcccgcacgccgattgggaaggcatatcgcggc
gctttcaacaatcttcccgctccgacgcttgccagccatgcgatcagcgcagcggtcagc
agggcaaagttggatcccgcggacatcgacgactgcatcatgggcagtgcattgcagcag
gggagccaggccacgatcggtcggaacgcggcgctgcgcgctggccttccggtcacggtc
gcgggcatgtcgatagaccggcagtgcgcatccggcctgatggcgattgcgaccgccgcc
aagcagatcatcgtcgatcgcatggacatcgtggtggcagggggcgtggagtcgatctca
ttggtccagaccgacgcccttcgcgtcgacgaagacccggaattggtcgcgcttcatggc
gatgcctacatcgccatgatcgacacggcggaaaatgtcgcacggcgctatggcgtcagc
cgcgcggcccaggacgaatattcgctccagtcgcaacagcgcaccgccgcggcacaggcc
gctggtctgttccaggacgagatcgtgcccgtgaccgcgacaatgatcgtgacggacaag
gcgactggagaaaagacgtccaggatcgtcactctcacgcaggatgaaggaaatcgcgcc
gacaccactcttgaggggcttgccggtctgaagccggtccgcgggcccgacgccttcatc
accgccggcaatgccagccagttgtcggacggtgcgtccgcatcggtgctgatggagcgc
caggtcgccgaggagcggggactgcaaccgcttggacgctatctcggaatggccgttgca
ggcactgagcccgatgaaatggggatagggcccgtgttcgccattcccaaactcctcgat
cgcttcggcctcggcatcggcgacatcggcctttgggaattgaacgaggcctttgcaagc
caggtcctctactgccgcgacgcgctgggcctgcccaatgaccgcctcaacgtgaatgga
gggggcatctccatcggccatccttatggtatgacgggtgcccggttagtgggtcatgcg
ctgctcgaagggcggcggcgcggcgagaaatatgtcgtcatcaccatgtgcgtcggaggc
ggcatgggggcggccggactgttcgaagtgctgtaa

DBGET integrated database retrieval system