KEGG   Sphingobium indicum: SIDU_17230Help
Entry
SIDU_17230        CDS       T04604                                 

Definition
(GenBank) quinohemoprotein alcohol dehydrogenase
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
sinb  Sphingobium indicum
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SIDU_17230
Enzymes [BR:sinb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     SIDU_17230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 Cytochrome_CBB3 PQQ_3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: APL96116
UniProt: A0A1L5BTA6
Position
3625781..3627895
Genome map
AA seq 704 aa AA seqDB search
MAKRSGRFHWARKGAVAAILFFGTAALAFQGEGRLVDDARLRAVDRGSGEWIVPAAGYSE
QRFSPHAQINVDTVKRLGLAWYADLGTDRGVEATPIVVDRILYNITPWNVTTAYDAVTGR
EIWRYDPQVPRRFGGFACCDINSRGVAAWKGKIFIATLDGRLIALDARTGKPMWSQQTLD
PGWAYTITGAPRVYDGKVIIGNAGAEAAAPGYVSAYDAETGRKLWRFNIVPGDPAKGYKS
KAEAMAAKTWKGEWWKQGGGGTAWDSFAYDPEARLVYIGTGNGGPWAQAVRSPGGGDNLF
LSSIVAVNVDTGAYVWHYQETPGDEWDYTATQSIILADMKFGGRNRKVLLHAPKNGFFYV
LDRRTGELLSAEPYVPGITWAKGIDRKTGRPIVNPEARYGETPVLVSPSAGGGHNWNPMA
YSPKTGLAYFPVLQSAMTYAFDPNFKVQPGEMHQLGIASTGHEELRKRHAAEIAAMTKVW
LTAWDPVKQKEVWRVPYARRGSGGALVTGGNLVFQGTIDANFAAYRADTGAKLWEMPVRQ
VPIAGAMSYVIDDVQYVAVNAGWGGGLAHGPNSNDSGMRLSTARLLVFRLDGKATLPPLP
VATAATVAAPPPDSAPAAQVDRGRALYATNCSGCHGDEARGGIKDLRKLTPGTRAQFYDI
VLGGIRADNGMVSFADKLSRADAEAIHAYLVHRANQDWDGHEVK
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcgtagtgggcggttccattgggcgcggaaaggggcagtcgcggcaatcctg
ttcttcggcacggctgcccttgcattccagggcgaggggagattggttgacgatgcgcga
ttgcgcgcggtggatcgcgggtcgggcgagtggatcgtccccgccgccggttacagcgag
cagcgtttcagcccgcacgcgcagatcaatgtcgataccgtcaagcggctgggcctcgcc
tggtacgccgatctcggcaccgaccgtggcgtggaggcgacgcccatcgtcgtcgaccgc
atactctacaacatcacgccttggaacgtgaccaccgcctatgatgcggtgaccggcagg
gagatctggcgctatgacccccaggtaccgcgccgctttggcggcttcgcttgctgcgac
atcaattcccgaggcgtcgcggcatggaaggggaagatcttcatcgccaccctcgacggc
cggttgatcgcgctcgacgccaggaccggcaagcccatgtggagccagcagacgctcgat
ccgggttgggcctatacgatcacgggcgcgccgcgcgtctatgacggcaaggtcatcatc
ggcaacgccggcgccgaggcggccgcgcccggttatgtctccgcttatgacgccgagacc
ggcaggaagctctggcgcttcaacatcgtccccggcgatcccgccaagggctacaaaagc
aaggccgaggcgatggccgccaagacctggaagggcgaatggtggaagcagggtggcggc
ggcaccgcatgggacagcttcgcctacgatccggaagcgcggctggtctatatcggcacc
ggcaatggcggcccctgggcgcaagcggtgcgtagcccgggcggcggcgacaatctcttc
ctgtcctcgatcgtcgcggtgaatgtcgataccggcgcttatgtctggcactatcaggaa
acgccgggcgacgaatgggactataccgcgacccagtcgatcatcctcgcggacatgaag
ttcggcgggcggaaccgcaaggtgctgctgcacgcgccgaagaacggcttcttctacgtg
ctcgaccgccgcaccggagagctgctttcggccgaaccctatgtgcccggcattacctgg
gccaagggcatcgacaggaaaaccggccgcccgatcgtgaatccagaggcgcgctacggc
gagacgccggtgctggtatcgccgagcgccggcggcgggcataactggaacccgatggcc
tatagtccgaagacgggcctcgcctatttcccggtgctccagagcgcgatgacatatgcg
ttcgatccgaacttcaaggttcagcccggtgagatgcaccagcttggcatcgcctccaca
ggtcatgaggaactgcgcaagcgccacgccgcggagatcgcggcgatgacgaaggtctgg
ctcaccgcctgggatccggtgaagcagaaggaagtctggcgcgtgccatacgcgcgccgc
ggcagcggtggcgcgctggtgacgggcggcaacctggtcttccaggggacgatagacgcc
aatttcgctgcctatcgggcagacaccggcgcgaagctttgggagatgccggtccggcag
gtgccgatcgccggcgcgatgagctatgtcatcgatgacgtgcaatatgtcgctgtcaac
gccggctggggcggcggcctcgcccatggcccgaacagcaacgactcagggatgcggctg
tcgaccgcccggctgctggtgttccgactggacggcaaggcgacgctgccgccgctcccg
gtcgcgaccgccgccacggtcgcggcgccgccgcccgacagcgcgccggcggcgcaggtc
gatcggggccgcgcgctctacgccaccaattgctccggctgccatggcgatgaggcgcgg
ggcggcatcaaggacctgcgcaaactgacgcccgggacgcgcgcgcaattctacgacatc
gtgctgggcggcatccgcgccgataacggcatggtgagcttcgccgataagctttcccgc
gccgacgccgaggcgatccacgcctatcttgtccatcgcgccaatcaggattgggacggc
catgaggtgaaatga

DBGET integrated database retrieval system