KEGG   Sesamum indicum (sesame): 105157135Help
Entry
105157135         CDS       T04135                                 

Definition
(RefSeq) strictosidine-O-beta-D-glucosidase-like
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00460  Cyanoamino acid metabolism
sind00500  Starch and sucrose metabolism
sind00940  Phenylpropanoid biosynthesis
sind01100  Metabolic pathways
sind01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105157135
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    105157135
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    105157135
Enzymes [BR:sind01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     105157135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 105157135
NCBI-ProteinID: XP_011071746
Position
LG3
AA seq 546 aa AA seqDB search
MQANTLNSAPTIHENGAGLTRSDFPEGFIFGTGTSSFQVEGAAAKGGKSISVWDDLTLRT
PNLIVDGSNGNVACDGYHRYKEDIKLMKNMGFDSYRFSISWPRILPGGRTCAGINKEGID
YYNDVINTVFDHGMKPFVTLFHWDIPNCLQLEYGGMLSDKVVDDFVEFAEICFQEFGDRV
KFWTTVNEPWTYAVRGYTPGDHFLDINAADKQGEVGRFPAHRACIRMKRLDSTTQPKRDT
WFLVNDPAKDAYTVARNLLLCHAAAVQSYRTNFKVVQEGEIGIVLNSSCHYRSQLLLGDE
SVKRAYDFMIGWFLEPVIYGQFPKTMLDNAKANIVPFSDKETQLLKRSVDFFGLNYYTAD
FVATESNPPGVGYPADQRCIYSSYDKKNNPVGEPTSLSWLYMVPKGLYDHMEYLKKQYGQ
DLPPMYITENGVADKNDSALTAKQACADTIRTRYHQEHLAYLRKAIYELQVDVRGYFAWS
YCDNFEWTDGYTARFGLVYIDYINNLTRYMKNSALWFMKFLKGRPTSEKRQVEMDSERGS
KKRRGT
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccaacactctcaactctgccccaacaatccatgaaaatggtgccggtttaacc
cgtagtgatttccctgagggttttatctttggaactggcacatcttcctttcaggtcgaa
ggagctgctgcaaaaggcggtaaaagcataagtgtatgggatgacttgacgctgagaact
ccaaatttgattgtggatggatccaacggaaatgttgcttgtgacgggtaccatagatac
aaggaagatattaagttgatgaagaacatgggctttgattcctacagattttcgatttca
tggccaagaattctgccaggcggaagaacttgtgctggaatcaacaaggaaggaatcgat
tactacaatgatgtcatcaatactgtgttcgatcacggcatgaaaccctttgtgactctc
tttcactgggatattcctaattgcttgcaactggagtatggtggcatgttgagcgataaa
gtagtggatgattttgtagagtttgcagagatatgctttcaggaattcggtgatcgggtg
aaattctggacaacggtaaacgagccatggacgtacgcggtgcgtgggtatacgcctggt
gatcacttcttagacatcaatgctgcagacaagcaaggagaagtagggcgctttcctgct
catagagcttgcatacgaatgaaacgattagactccacaactcagcccaaaagggacact
tggtttcttgtgaatgatccggccaaagatgcatataccgtggcaagaaatttgcttctt
tgccatgcggcagcagttcaatcgtaccgaaccaattttaaggtagttcaagaaggcgaa
ataggaattgttcttaattccagttgtcactatcgatctcaactgcttttgggcgatgaa
tcagtcaaaagagcctatgattttatgataggctggtttttggaacccgtaatatatggc
caatttccaaaaacgatgttggataatgctaaggccaacattgtccctttctcagacaag
gaaacacaactgctcaaacgttcggttgatttttttggtctgaattactacacagcagat
tttgttgctactgagagtaaccctccaggtgttggctaccctgcagatcaacgttgtatt
tacagttcttacgacaaaaaaaataatccagtcggagaacccacttctttatcatggttg
tatatggttccaaaaggattatatgaccacatggagtatctaaaaaaacaatatggccaa
gacttgcctcctatgtacattactgaaaatggagttgccgataaaaatgactctgcgctc
acagctaaacaagcttgcgcagacacaataaggactcgatatcatcaagagcatctcgcc
tatcttcgaaaagcaatatatgaattgcaggttgacgtaaggggctattttgcttggtcg
tactgtgataattttgaatggaccgacggatacacagcgagatttggtttggtctacata
gactatataaataacttgacacgatacatgaaaaattcagctctgtggtttatgaagttt
ttaaaggggcgaccaacttcagagaagagacaagttgagatggattcagagcgtggatcc
aagaaaaggagaggtacataa

DBGET integrated database retrieval system