KEGG   Sesamum indicum (sesame): 105159091Help
Entry
105159091         CDS       T04135                                 

Definition
(RefSeq) 70 kDa peptidyl-prolyl isomerase isoform X4
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
sind  Sesamum indicum (sesame)
Brite
KEGG Orthology (KO) [BR:sind00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sind03110]
    105159091
Enzymes [BR:sind01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     105159091
Chaperones and folding catalysts [BR:sind03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    105159091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 FKBP_N_2 TPR_19 TPR_8 TPR_11
Motif
Other DBs
NCBI-GeneID: 105159091
NCBI-ProteinID: XP_011074339
Position
LG3
AA seq 598 aa AA seqDB search
MVEFSKVNLKDIEEDDEGEEEGEEVESAPPLKVGEEREIGSNGLKKKLMKRGLNWETPQF
GDEVTVHYVGSLSDGSIFISTRASNEPFTLKLGRGDIVIGLDHGIVTMRRGEVALFTLPP
ELAYGASGRAGIPPNAVVQLEVELLSWITVVDVCKDGGIIKKILENGEQIGPPGDLDEVR
VNYKAMLVDGTIVADTRDEGVEFYIKDGHFCPALVKAIKTMKKGERVNLVVQPQYGFGEV
GKKSNELPSIPPKSTLSISAELLSFKRVIDITGDLKVKKKVLREGEGTVTANEGAAVTVR
YKAMLEDGTVFERKGIDGEQPLEFITDEEQTIVGLDRAVSTMKKNEYALVTISPEYGFGS
TEVKQDLAVVPPSSTILYEVEMLDFVREKAPWEMSNAERIEAAAWKKEEGNQLFKNGKYQ
RAAKKYDKVLQAADYVGEDGYLTGDDEKVVKSLRVSCWLNGAACSLKLNNFGEAINLCSK
ILDVESCNVKALYRRAQAYMGISELHSAEMDIKRASEADPHNREIKLIQKSLKQLQAESN
RRDAKLYKAMFPSTSKDASTAAKRLKTGEDDTRDEYVSAMEAGNASVDQAASDTTAKT
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggtggaattctcgaaagtgaatcttaaagacatcgaggaagatgatgaaggagaagag
gagggggaagaagtcgaatcagcgccgccactgaaagtgggcgaagagagagaaataggc
tcaaatgggctcaagaaaaagctcatgaaacggggccttaattgggagacccctcaattc
ggtgatgaggttaccgttcactatgtgggaagtttgtcagatgggagtatatttatttca
acaagggctagcaatgagcccttcactttgaagcttggacgtggggatatagttatcggg
ttggatcatggaattgttacaatgagaagaggggaagtggcgctattcaccctgcctcca
gaactagcatatggagcatcaggaagggctggcatacctccaaatgctgttgttcagctt
gaagtagaactcttatcatggattaccgtggtggacgtctgtaaggacggtggaattatc
aagaaaatccttgagaatggggaacagattgggcctcctggtgatctagatgaagttcgt
gttaattataaggcgatgctggttgatggcaccattgtagcagacacacgtgacgagggc
gtggagttttatattaaagatggccacttttgtccagcattagtgaaagcaattaagacc
atgaagaagggagagcgggtcaatttggttgttcaaccacagtatggctttggggaggtg
ggtaagaagtcaaatgagcttccttcaatcccccctaaatctactctgagcatttctgcg
gagcttctttcatttaagagagtaatagatattactggtgatttgaaagtaaaaaagaag
gttttaagggaaggtgaaggtactgtcacagcgaatgaaggtgctgctgttactgttagg
tacaaagcaatgttagaggatggtactgtatttgagagaaagggtattgatggcgagcag
ccactggagttcatcacagatgaagagcaaacaattgtcggactagatcgagcagtaagc
acaatgaagaaaaatgaatatgcattagtaactatttcccctgaatatggatttggaagc
actgaagtaaagcaggatcttgctgtggttccaccatcatcaactattctatatgaagtt
gaaatgttagatttcgtcagggaaaaagcaccttgggaaatgagcaatgcagagaggatt
gaggcagctgcttggaagaaagaagaaggtaatcaactctttaaaaatgggaaataccaa
agagctgcaaagaaatatgacaaggtacttcaggcagctgattatgtgggcgaagatgga
tatttgacgggcgatgatgagaaagtggttaaatcattgagggtctcatgctggttgaat
ggtgcagcttgttctctgaaactaaataatttcggggaagcaatcaatctctgttcaaag
atcctcgacgtagagtcttgcaatgtgaaagcactgtacaggagagctcaagcttatatg
gggatttcagagttgcactcagctgaaatggacataaaaagggcctcagaagcagatcct
cataacagggagatcaagttaatacagaagagtttgaaacaactccaagcggagagcaat
agaagagatgcaaagctctataaagcaatgtttccaagtacgagcaaagatgcttctact
gcagcaaagaggctgaaaacgggagaggatgatacgagggatgagtatgtttcagctatg
gaagccggaaatgcatcagtagatcaagctgcttctgatacaacagctaaaacatga

DBGET integrated database retrieval system