KEGG   Sesamum indicum (sesame): 105160857Help
Entry
105160857         CDS       T04135                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00010  Glycolysis / Gluconeogenesis
sind00562  Inositol phosphate metabolism
sind01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105160857
   00562 Inositol phosphate metabolism
    105160857
Enzymes [BR:sind01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105160857
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105160857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 105160857
NCBI-ProteinID: XP_011076657
Position
LG4
AA seq 493 aa AA seqDB search
MAAPPATVLFLLLLFPAAVFPNAEENFDVRRHLSTATRYHIAKDISENSFVPSNIPDQCT
PIHLNLVARHGTRAPTKKKLKELEALVSRLKVLLENVKEQKSTGIPTWLWGWKSPWTGKH
KGGELIREGENELYELGIRTREQFPDLFNEDYHPDIYPIKATQVSRASASAVAFGMGLFS
DRGNLGPGRHRAFAVTSESRASDIMLRFHDCCQNYKAFRKNQEPSVDKLKEPILNEVTQQ
LVKRWGLNFTRSDISSLWFLCKQEASLLNTTDQACALFTPSEVGLLEWADDLEVFVLKGY
GNSLNYRMGVPLLEDVIQSMEQAIKAKEDGLVSGSYEMARLRFAHAETLLPFSCLIGLFL
DGPEFEQILREQPLELPVKPPKKRIWRGSSVAPFAGNNMLVLYSCPANNSSRYFVQVLHN
ERPTPLAGCGNSDFCPFELFKERIAAPHLKHDYNALCSMELEQSKQTAPTNKFAQILSWF
FPGDSKQPQNAEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcagccccaccggcgactgtattgttcttattattattgtttcctgcagcggtgttt
ccaaacgccgaagaaaatttcgacgttcgccgccatttatccactgctaccaggtatcat
attgcgaaggatatttctgagaattcatttgttccttcaaatatccccgatcagtgtaca
cctattcacttaaatcttgtggcaaggcatggaactcgtgctcctaccaagaaaaagctg
aaagaactagaagccttggtctctcgcctcaaagtgctattagaaaatgtaaaagagcag
aagtcaacaggcattcctacatggttatggggatggaaatctccttggacaggaaagcac
aagggtggagagttaattcgtgaaggagaaaatgaactgtatgagcttggtattagaacc
agggaacaatttccagacctctttaatgaggattaccaccctgatatatatcctattaaa
gccactcaggtttcacgagcctcggctagtgctgttgcatttggcatggggctctttagt
gatcgaggaaatctaggaccaggacgtcatcgagcttttgcagttaccagtgaaagccgt
gcaagtgatataatgttgagattccatgattgctgtcaaaactataaggcattcaggaaa
aatcaggaaccatctgttgataagctcaaggaacccatattaaatgaagtaactcaacaa
ttagttaagcgttggggtctaaatttcactagatcggatatatcatctttgtggttcctt
tgcaaacaggaagcttctttattgaacacaactgatcaagcttgtgccttgttcactcca
tctgaggttggtttgcttgagtgggcagatgatttagaggtcttcgtcctgaaaggttat
ggtaattcactgaattaccggatgggagttccattgcttgaagatgtcatccagtcaatg
gagcaagctattaaggctaaagaagatggacttgtttctggaagctatgaaatggcaaga
ctccgatttgctcatgcagaaactttgcttccattttcctgtttgattgggctatttctt
gacggacctgagtttgaacaaatactgagagagcaacctctggaactacctgttaaacct
cccaaaaagagaatctggcgtggtagctcagtcgccccatttgctggaaataacatgcta
gttctatatagctgcccggccaacaattcaagcagatactttgtacaagtactgcacaat
gaacgtcccactccactggcaggctgcggaaactctgacttttgcccatttgagctgttt
aaggaaagaatagctgctcctcatttgaagcacgactacaacgctctttgcagcatggag
ttggaacaatcaaagcaaacagccccgaccaataagtttgcacaaatattgagttggttt
ttccccggcgattctaaacaaccccagaatgctgagttatag

DBGET integrated database retrieval system