KEGG   Sesamum indicum (sesame): 105163124Help
Entry
105163124         CDS       T04135                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 2-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00520  Amino sugar and nucleotide sugar metabolism
sind01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    105163124
Enzymes [BR:sind01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     105163124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-GeneID: 105163124
NCBI-ProteinID: XP_011079661
Position
LG6
AA seq 427 aa AA seqDB search
MGSELIFRGHDESQPVTDSYSPKPQKPWFNVTRPICYMLREQRLLFVFVGIAIATLVFAF
VPSSNPQAPIPDAYFSTELTQLQPHRSMYQNGHLATGFGINSVGKIPLGLKRKGLRIVVT
GGAGFVGSHLVDRLISRGDSVIVVDNFFTGRKENVVHHFGNPRFELIRHDVVEPLLLEVD
QIYHLACPASPVHYKHNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSEVYGDPLQHPQ
VETYWGNVNPIGVRSWTAETLTMDYHRGAGVEVRIARIFNTYGPRMCIDDGRVVSNFVAQ
ALRKEPLTVYGDGKQTRSFQYVSDLVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVQE
TIDPNAKIEFRPNTEDDPHKRKPDITKAKDLLGWEPKVPLRKGLPMMVSDFRQRIFGDHK
QDVASSA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgagttaatattccgaggccacgacgagtcgcaacccgtgaccgactcctac
tcgccgaagccgcagaagccctggttcaacgtcactcggccgatttgctacatgctccgc
gaacagcgactccttttcgtgttcgtcggcattgctatcgcaacgctcgttttcgctttc
gtaccttcctccaatccccaggcgccgatcccggacgcgtacttttcgaccgagttgact
cagctccagccgcaccgatccatgtaccagaacggccacttggccaccgggttcggaatc
aactcggtcggaaaaattccgctgggattgaaacgtaagggtttgcgaattgtcgtaacg
ggcggggctgggtttgtcggcagccatttggtggatcgtttgattagcagaggagacagt
gtgattgtagtggataatttcttcacggggagaaaggagaacgtggtgcaccactttgga
aatcccaggtttgaactgattcgacatgacgtcgttgagccgctgctgttggaagtcgac
cagatctaccacctcgcttgccctgcctcgcctgttcattacaagcacaaccccgtcaag
accatcaagacgaatgtggtggggacgctgaacatgctgggtctggcgaagagagtcggt
gcacggtttctgctaacgagcaccagcgaggtatacggtgatccattgcaacacccccaa
gttgagacctactggggcaacgtcaacccaatcggtgtgcggagctggactgctgaaacg
ttgaccatggactatcacagaggtgctggcgttgaggttaggattgcaagaatcttcaac
acatacggtccccgtatgtgcattgatgacggtcgtgtggttagcaactttgttgctcag
gctttgaggaaggagccattaacagtgtatggtgatgggaagcagacaagaagttttcag
tatgtctccgatctggttgagggactaatgcggttgatggaaggagagcatgttggacct
ttcaatcttggtaacccaggcgaattcactatgcttgaacttgctcaggtggttcaagaa
accattgatccaaatgcaaagatagaattcaggcccaacacagaggatgatccacacaag
agaaagcccgacattaccaaggcgaaggatctgctgggttgggaacccaaagtgccactg
cgcaaaggtctacccatgatggtctcagacttcaggcaaaggatatttggtgaccacaaa
caagatgtggcttcctcagcataa

DBGET integrated database retrieval system