KEGG   Sesamum indicum (sesame): 105165104Help
Entry
105165104         CDS       T04135                                 

Definition
(RefSeq) probable carotenoid cleavage dioxygenase 4, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00906  Carotenoid biosynthesis
sind01100  Metabolic pathways
sind01110  Biosynthesis of secondary metabolites
Module
sind_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    105165104
Enzymes [BR:sind01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     105165104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 105165104
NCBI-ProteinID: XP_011082281
Position
LG6
AA seq 571 aa AA seqDB search
MIVPQLVIVPSLGTQEKYLQTKNTISSKSKKKSITVSKHYIRLVENNGSKRRSNKSLATI
FFKSLDDFISTYMDLPLRPCIDPMHVLSGNFAPVDELPPTPCHVDEGSLPSALDGVYIRN
GPNPQFIPHGPFHVFDGDGMLHSIRISNGEAVFCSRYVKTCKYMAEQKMGYPFIVSPFSS
FNGTAAAIARFVLGVARKLAGHFDPMVNGFGTANTSLAMFGGMLFALCESDLPYQVRVTS
DADIITVSRHDLYTNDPTLRMTAHPKIDSETGEVFAFRCDIVPPFLTFFRVDTSGRKGPD
VPISSLERALVVHDFALSKNFIIFQDTQVGINLMDMMRGKSVMVFKPDKVPRLGILPRYA
HDETELVWIDAPGFNMLHSINAWEEEFGKKVVILAPNLLSIEQGLEDTSLYHSVIEKLTI
DVETKQVVRRSLCNENLEFGVINPAYAGKKNRYVYAGVAAQLPRVRGVMKLDVSRLTADG
GDCTVASRLYGLGWYGGEACFVPREPDNPAAEEDDGFLVTYVHNEENEESWFIVMNAKSP
TLDIVARVRLPGRVPYGFHGLFVREADRKLT
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgatagttcctcaactagtgattgttccatcacttggaactcaagagaagtacctccaa
accaagaatactatcagttccaagtccaaaaagaagtcaattacagtatcaaaacattac
ataagattggtcgaaaataatgggagcaaaagaagaagcaacaaatccttagcaaccata
ttctttaagtcattagatgacttcatatccacctacatggacttgccccttcgcccatgc
atcgaccccatgcacgttctctccggtaacttcgcccccgttgacgagcttcctcccact
ccatgtcacgtcgatgagggtagcctgcctagtgctcttgacggtgtgtacatccgcaac
ggccccaatcctcagttcatccctcacggcccgttccatgtttttgatggagatggaatg
ctgcactctatccgaatatccaatggggaagctgttttctgtagtcgatatgttaagact
tgtaagtacatggcggagcagaaaatggggtatccgttcattgtaagtccattttcttcc
ttcaacggcacagcggctgccatcgcacgtttcgtgctaggtgtagcacgaaagctagcc
ggacacttcgaccctatggtcaatggctttggaacggcgaacactagtttagccatgttt
ggtgggatgctctttgctctctgcgagtctgatcttccctaccaagtaagagtaacatct
gatgcagacataatcactgtctcccgccatgatctttacaccaatgacccgaccttgaga
atgactgctcatccaaagatcgactcagagacaggtgaagtttttgcgttcagatgcgac
atagttcctccattcttgacatttttccgggtcgacacaagcgggagaaagggcccggat
gtgccgatttcctccctggagagagcgctagtggttcatgattttgctctttccaaaaac
ttcattattttccaagacacgcaggtgggaatcaaccttatggacatgatgagaggaaaa
tcggtaatggtgttcaagccggacaaagtgccgaggctaggaatcttgccacgatacgcc
catgacgagactgaactagtgtggattgatgctccaggattcaacatgctacattcaatt
aatgcttgggaagaagaatttgggaaaaaagttgtaatcctggctccaaatctactatcc
atcgagcagggattggaggacacaagtttatatcactcggtgatcgaaaagttaaccata
gatgttgaaacaaagcaggttgtaaggcgttcattgtgcaacgaaaacctcgagttcgga
gtcattaatccagcttatgctggaaagaagaacaggtacgtgtatgcaggcgtagcagct
cagctaccgagggtgagaggagtcatgaaacttgacgtctcccgactaactgcggatggc
ggggactgcacggtggctagcaggctgtatgggctgggttggtacggcggtgaagcttgt
ttcgtgccgagagagcccgataatccggcggctgaagaggacgatggtttcctggtaaca
tatgtgcacaatgaggaaaatgaggaatcctggttcatagtcatgaacgctaaatctcca
actctagacattgttgctagagttagattgcctggtcgtgtgccttatggcttccacggg
ctgtttgtcagggaagctgaccgcaaactaacatag

DBGET integrated database retrieval system