KEGG   Sesamum indicum (sesame): 105167380Help
Entry
105167380         CDS       T04135                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
sind  Sesamum indicum (sesame)
Brite
KEGG Orthology (KO) [BR:sind00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105167380
Enzymes [BR:sind01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     105167380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 DAO Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 105167380
NCBI-ProteinID: XP_011085370
Position
LG8
AA seq 571 aa AA seqDB search
MRFFCYFNRFLHDHPTSTKLLLLSSLSSGGVVAYAEGKKSVSPQEITQKKRVVVLGTGWA
GTSFLKDLDISTYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIIKKRNGEIKF
WEAECLKIDPVKKSVLCRSNIDENLAGNNEFSLEYDYLVIAIGAKVNTFNTPGVMENCHF
LKEVEDAQRIRRAVIDCFEKAVLPGLTEEERRTNLHFVIVGGGPTGVEFAAELHDFVHED
LVNIYPSVGDLVRITVIQSGDHILNTFDERISSFAESKFQRDGIEVLTGHRVMSVSDRMI
NMTAKSTGEDVAIPHGMVVWSTGVGTRPVIQDLMEQIDQGNRRILATDEWLRVKGCADVY
ALGDCTTVDQKKIVEDISEIFRAADKDNSGTLTIEEFQDVIEDVVIRYPQVELYLKSKHL
FSVSDLLKDMYSNNREEIDIEEFKSALSLVDKQTKSLPATAQVAAQQGTYLSSCFNKMEK
CKQNPEGPRKFRSGGRHEFRPFRYRHLGQFAPLGGEQAAAELPGDWVSMGRSTQWLWYSV
YASKQVSWRTRLLVMGDWSRRYIFGRDSSRI
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgagatttttctgctacttcaacagatttctgcatgaccaccccacttcaaccaagctt
ttgcttctttcttcactcagcagcggaggtgtagtggcgtatgcagaagggaaaaagtca
gtttctccacaggaaattacacaaaagaaaagagtggtagttcttggaacaggatgggct
ggtactagcttcctcaaagatctcgacatctccacgtacgacgttcaggtcgtttcgcct
aggaactattttgcgttcacgccgttgctgcccagcgtcacctgtggaacggtcgaggca
cggagcatcgttgagcctgttcgaaacatcataaagaagaggaacggcgaaatcaagttc
tgggaggcggaatgcctcaagatcgatccagtgaaaaaaagcgtcttgtgccgctccaac
atcgatgaaaatttagctgggaataatgagttctctttggaatacgattacttagttata
gccattggagctaaagtgaatacgttcaacactcctggcgtgatggaaaactgccatttc
ctgaaggaagtcgaggatgctcagaggatccgtcgggctgtaatcgattgctttgagaag
gcagttcttccggggctgactgaggaagagcgaagaacgaatctccatttcgtgatcgta
ggagggggtccgaccggcgtggagtttgctgcggagcttcatgatttcgttcatgaagat
ctggtgaacatctatccctcggttggagatttagtgaggataactgtcatacaatctggg
gaccatattttgaacacgtttgatgaaaggataagctcatttgccgaatcgaagtttcag
agagatggtattgaagtcctaacaggacaccgtgtcatgagcgtgtcagatcgaatgatt
aatatgacagcaaaatctactggagaggatgttgccattcctcatggaatggttgtgtgg
tcaactggggttggaactcgaccagttatccaggaccttatggaacaaattgatcagggt
aataggcgtattctagcaactgatgaatggttgcgagtaaagggatgtgctgatgtatat
gctcttggtgattgtaccactgtagatcagaaaaagatcgtggaagatatctcggagata
ttcagggctgcagacaaagacaactccggcaccttaaccatcgaggaattccaagacgtg
atcgaagatgtggtcatccggtacccgcaagtggaattgtacctgaagagcaagcatctg
ttcagtgtgtccgacttgctcaaagacatgtacagtaacaatagagaagagatagacata
gaagagttcaagtcggcgttatcgcttgtggataagcagaccaagagccttcctgccact
gctcaagttgctgctcaacaaggtacttatctttcaagctgcttcaacaagatggaaaaa
tgtaagcagaatcctgagggccctcgcaagttcaggagtggcggtcgtcatgaattccgt
cctttcaggtaccgacatcttgggcaattcgccccccttggtggggagcaggcagccgct
gagttgccgggagactgggtttcaatgggccgtagcactcagtggctttggtattcagta
tatgcaagtaagcaagtgagctggcggacaaggttgctagtcatgggtgattggtcgagg
agatacattttcgggagagattcaagtcgcatctga

DBGET integrated database retrieval system