KEGG   Sesamum indicum (sesame): 105167919Help
Entry
105167919         CDS       T04135                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00601  Glycosphingolipid biosynthesis - lacto and neolacto series
sind00603  Glycosphingolipid biosynthesis - globo and isoglobo series
sind01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    105167919
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    105167919
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sind01003]
    105167919
Enzymes [BR:sind01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     105167919
Glycosyltransferases [BR:sind01003]
 Glycan extension
  P blood group
   105167919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth
Motif
Other DBs
NCBI-GeneID: 105167919
NCBI-ProteinID: XP_011086099
Position
LG8
AA seq 433 aa AA seqDB search
MEEIDTFLSQLLFHLQRSKRSFYALISLLLLCLIAYNSATIFCTHVPISAEVPPGPSSFS
PENVSGDSRKFFSVNSSAKLSSAALFSVKGESSSAKLKTHLPLLHKNRNLVVRTTVHHSK
RRDRSAKVKQFEDRVMEFFNPNSSDWSCKFRFFMTWISSAESFGDRELFAMNSLFKVHPR
GCLIVASNSLDSRSGMQILRPFLEKGLKVTAISPDFNYLFKNTPAQAWYNQLMQGNVNPG
EVPLGQNLSNLLRLGLLYRFGGIYLDTDIIVLKSFGGLKNAIGAQTVDLDTGKWSRLNNA
VMIFDEGHPLLYKFIQEFALTFDGNKWGHNGPYLVSRVVSRVTGRPGYNFTVLPPMAFYP
VDWSKIGSLFQGPQNLNHSKWLLAKLRQIRSLSFAVHLWNKQSRGFEVQKGSVIQHIMFS
SGASYNSSTVSTE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaagagattgacactttcttgtctcagcttcttttccatttgcaaagaagcaagaga
tctttctatgctttgatttctcttcttttgctatgtctaattgcttataatagtgccact
atattctgtacacacgtcccaatttcagcagaagttccgccgggaccgtccagtttctca
ccggaaaatgtctcgggagattcaagaaagttcttttcagtcaattcttcagccaaactg
tcatctgctgcgctgttttcggtgaaaggagaaagctcaagtgcaaaattgaaaacccat
ttgccccttttgcataaaaatcgaaacttggtggttagaactactgtgcatcactcaaag
agaagggacaggagtgctaaagtgaagcagtttgaagatagagtgatggagttcttcaat
cccaattcatcagattggtcttgtaagtttcgatttttcatgacttggatttcttcagct
gagtctttcggagatagagagttgtttgctatgaacagtttgtttaaagtacatccaaga
ggctgcttaatcgtagcgtcaaattcactggattcaagaagtgggatgcaaatcttgaga
cccttcttggaaaaggggttgaaagtgactgcaatttctcctgacttcaattatttgttc
aagaacactcctgctcaggcttggtacaaccagttaatgcaaggaaatgtaaatcctggg
gaggtccctttaggccagaacctctcaaatttactcagattgggtttgctgtacaggttt
ggtgggatttatttagacacagatatcatagttttgaagagttttggggggctcaagaat
gcaattggagctcaaactgttgatcttgatacaggaaaatggagcagattaaataatgct
gtgatgatctttgatgagggtcatccgctgctttacaagttcattcaagaattcgcgctt
acgttcgatgggaacaaatggggtcataatggaccttacttggtttcaagagttgtttcc
agggtgactggaaggcctggctacaatttcacggtcttgccgcctatggcgttttatccg
gtggattggagcaagattggaagtctttttcagggacctcagaatttgaatcactcaaaa
tggttgcttgcaaaactcagacaaatccgcagcctgagttttgctgtgcatctctggaat
aagcagagtagaggatttgaggttcaaaaaggaagcgttatccaacatataatgttcagt
tctggtgcctcgtacaattcttctactgtcagtacagaatga

DBGET integrated database retrieval system