KEGG   Sesamum indicum (sesame): 105169069Help
Entry
105169069         CDS       T04135                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase isoform X1
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00511  Other glycan degradation
sind00600  Sphingolipid metabolism
sind01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    105169069
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    105169069
Enzymes [BR:sind01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     105169069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N EF-hand_5
Motif
Other DBs
NCBI-GeneID: 105169069
NCBI-ProteinID: XP_011087641
Position
LG8
AA seq 961 aa AA seqDB search
MNLACSMKPGNMSENGFYGGEGESALHDHDEKVKVDPGTPPSLTWKRKLSTEENSLSEFS
LSLKEIIGMAPIGYRLWRHLRQEKSDHGEVFLDPFTKRHTSSCHGVPVGGIGAGSIGRSC
RGEFMRWQLFPRVCEDKPVLANQFSIFVSRPNGEKFSSVLCPKSPDILHDKSASGIESWD
WNLGGQNSTYHALFPRSWTVYDGEPDPALKVACRQLSPFIPHNYKESSFPVAVFTFTLSN
LGKTEADVTLLFSWANSVGGDSGLSGHHFNSKFRTEDNISGVLLHHMTAKGLPSVTFAIA
AEGTDTIHVSECPSFVISGNSNGISARDMWNEIKERGSFDHLNSEEMSMPSEPGSLIGAA
VAASLAIPAGTVQTVTFSLAWACPEINFHGGRTYHRRYTKFYGTHSNVASDIARDAIIEH
HKWESEIDVWQRPILDDKRLPEWYPPTLFNELYYLNSGGTIWTDGSPPVHSLRTIQQRRY
SIDRSNSDFRSGEDTSEQNDTAINILGRMTSLLQEIHSPVSMTSALGTNLLHKREENVGQ
FLYFEGIEYHMCNTYDVHFYASFALAMLFPKLELSIQRDFAAAVMMHDPSKMTLLQDGTW
VQRKVLGAVPHDIGMRDPWFEVNFYNLHNTDRWKDLNPKFVLQVYRDVVATGNKEFAEAV
WPSVYVAMAYMEQFDKDGDGMIENEGFPDQTYDTWSVSGVSAYCGGLWVAALQAASALAH
VVGDKGSEDYFWFRFQKAKKVYEKLWNGSYFNYDNSGSKTSSSIQADQLAGNWYARACGL
FPIVDEEKARKALEKIYNFNVLKVKNGRVGAANGMLPNGEPDMCTLQSREIWSGVTYAVA
AGMIHENMVETAFKTAVGVYEVAWSEQGSGYAFQTPEGWDFEGRYRSLGYMRPLAIWAMQ
WALTQHKIPRQEMKAEIKEESVIRQHTGFKRVAHLLKLSDEADSRSLFQVIFDYTCKRML
G
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggcttgctcaatgaagccgggaaatatgtctgagaatggtttttatggagga
gaaggggaatctgctttgcatgatcatgatgaaaaggtcaaagttgatccggggacacct
ccatccctgacttggaaaagaaaactgagtactgaggagaattccctttctgaattcagt
ctatctttaaaagagataatcggcatggcccctataggttataggctgtggcggcacctt
cgacaggaaaagtccgaccacggtgaggtatttcttgatccttttacaaagcgccataca
tcatcttgccatggggttcctgtaggcggtatcggtgctggaagcattggaagaagctgc
agaggtgaatttatgcgttggcaactatttcctagggtctgtgaagataagccagtcttg
gcaaaccaattttctatatttgtttcacggcctaatggtgaaaagttttctagtgtacta
tgcccaaagagcccagacattttgcatgacaagtcagcttctggaatagaatcttgggac
tggaatttgggtgggcaaaattccacgtaccatgcattgttcccaaggtcttggactgta
tatgatggtgaacctgatccagctctaaaagtagcatgtcgacaactttcaccctttatc
ccccacaactataaggagagcagcttccctgtggcagtgtttacttttacgttgtctaat
ttgggaaagacagaagcggatgtcaccttgctttttagttgggcaaattctgttggtggc
gattcaggactctctggccaccatttcaattcaaaatttaggacagaggataacatcagt
ggagttctcttgcaccacatgactgcaaagggactgccctcagtaacttttgcaattgca
gcagaagggaccgacacaattcatgtatctgagtgcccctcttttgtgatatctggaaac
tcgaatggtatctcagcaagagacatgtggaatgaaattaaagagcgtggatcattcgac
cacctaaattctgaagaaatgtcaatgccttctgaacctggttcacttattggggcggcc
gttgcagcttcactggcaattccagcaggaacagtacaaactgttacattttcattggca
tgggcttgccccgaaataaactttcatggtggaagaacttatcacaggcgttacactaaa
ttctatggtacacatagtaacgtggcatcggatattgcacgggatgctattattgagcat
cacaaatgggagtcagaaattgatgtatggcaaaggcctattcttgatgacaagaggctt
cctgaatggtaccctccaactctcttcaacgagctttactatcttaactcaggcggaaca
atttggacagatggatctccaccagtacatagtttacggactattcagcaacgaaggtac
tccattgatagatccaattcagattttagaagtggagaagatacatctgagcaaaatgac
acagcaatcaacatacttggaaggatgacctccttacttcaggagattcatagccctgta
tcaatgacttctgcattggggacaaatttgcttcacaaaagagaggaaaatgtgggacag
ttcctttactttgaaggcattgaatatcatatgtgtaatacatatgatgtccatttttat
gcatcgtttgcattggctatgctgttccccaaacttgaactcagcatacagagagatttt
gctgctgcagtgatgatgcatgatcctagtaagatgacacttttacaggatggaacatgg
gtccagagaaaggttcttggtgctgttcctcatgacattggaatgagagatccatggttt
gaagtaaatttctataaccttcataatacggataggtggaaagatttgaatccaaagttt
gtgctccaagtttacagagatgtcgttgccactggcaataaagagtttgctgaagctgtt
tggccatcggtctatgtagccatggcttacatggaacaatttgacaaggatggagatgga
atgatagaaaatgaagggtttcccgaccagacatatgatacatggtctgtatctggtgtg
agtgcatactgcggcggcttatgggtagcagctttgcaggctgcttcagcacttgctcat
gtggttggggacaagggttctgaggattacttctggtttaggtttcaaaaagcaaagaaa
gtgtatgaaaagttatggaatggttcgtattttaactatgacaacagtgggagtaaaaca
agctcttccattcaggctgatcaattggctggaaattggtatgctcgagcttgcggtctt
tttcccattgttgatgaagaaaaggcacgaaaagcgcttgagaagatttacaatttcaac
gtcttgaaggtaaaaaatgggagggttggagcagcaaatgggatgctgccaaatggagaa
cctgatatgtgtaccctacagtcaagagaaatatggagtggagttacatatgctgttgct
gcaggcatgattcatgaaaatatggttgaaactgcatttaaaactgcagttggtgtgtat
gaagtagcttggtctgagcaaggttccggatatgctttccagacccccgaaggttgggac
tttgaagggcgttatagatctcttgggtacatgcgtcctttagcaatctgggcaatgcaa
tgggcacttacacaacataagatcccaagacaggaaatgaaggcagagatcaaggaagaa
tctgtgatcaggcaacatactggttttaaaagagtggctcatctgctaaagctgtcagat
gaagctgattccagaagccttttccaggtcatatttgattacacttgtaaaaggatgttg
ggatga

DBGET integrated database retrieval system