KEGG   Sesamum indicum (sesame): 105170120Help
Entry
105170120         CDS       T04135                                 

Definition
(RefSeq) FK506-binding protein 2-like
  KO
K09569  FK506-binding protein 2 [EC:5.2.1.8]
Organism
sind  Sesamum indicum (sesame)
Brite
KEGG Orthology (KO) [BR:sind00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sind03110]
    105170120
Enzymes [BR:sind01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     105170120
Chaperones and folding catalysts [BR:sind03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    105170120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 105170120
NCBI-ProteinID: XP_011089043
Position
LG9
AA seq 153 aa AA seqDB search
MRPTSALNVASIFLLLAFIALGSAKKSGDVTELQIGVKYKPKTCDVQAHKGDSVKVHYRG
KLTDGTVFDSSFERGDPIDFELGSGQVIKGWDQGILGMCLGEKRKLKIPSKLGYGEQGSP
PTIPGGATLIFDTELVGVNGKTLNDGKSDESEL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaggccaacctctgcgttgaacgtcgcttcaatctttcttcttctggctttcattgca
ttaggttcggcgaagaaatctggagatgtgacggagctacagattggtgtgaagtacaag
cccaaaacttgtgacgttcaggctcacaaaggcgacagtgttaaagtgcactacagggga
aagcttacagatggaactgtttttgattccagctttgaaaggggagatccaattgatttt
gaactgggcagtggtcaagtaattaaaggatgggatcaaggaatactagggatgtgcttg
ggagagaaacggaagttgaaaattccttctaaacttggttatggagagcaagggtcccca
cctaccatcccaggtggtgcaacactcatctttgacactgagcttgtaggagtgaatggg
aaaacactgaatgatggaaaatcagatgagagcgaactataa

DBGET integrated database retrieval system