KEGG   Sesamum indicum (sesame): 105171018Help
Entry
105171018         CDS       T04135                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial isoform X1
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
sind  Sesamum indicum (sesame)
Brite
KEGG Orthology (KO) [BR:sind00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105171018
Enzymes [BR:sind01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     105171018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 105171018
NCBI-ProteinID: XP_011090313
Position
LG9
AA seq 501 aa AA seqDB search
MPWFRNFIQLSATFSKQSPSSSPRRAAAAIFVTRSPSLTQLLRHFSTHPQEKYPGLGPTK
GDEKPRVVVLGSGWAGCRLIKDIDTKIYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAE
PIGRIQPAISREPGSYFFLANCTGVDFQNHQVHCQTVTEGVETLDPWNFKVAYDKLVIAS
GAQASTFGIKGANEHATFLREVHHAQEIRRKLLLNLMLSDVPGITDEEKRRLLHCVVVGG
GPTGVEFSGELSDFIQKDVHQRYAHVKDYIHVTLVEANEILSSFDDRLRKYAIKQLTKSG
VRLVRGIVKDVQAEKIILSDDTEIPYGVLVWSTGVGPSAFVNSLEIPKAPGGRIGIDEWQ
RVPSVQDVFAIGDCSGFLENTGRPVLPALAQVAERQGKYLAKLLNHLGKAGGGRADAAKE
LDFGSPFVYRHLGSMATIGRYKALVDLRQSKEGKGLSLAGFVSWFIWRSAYLTRVVSWRN
RFYVAINWLTTFVFGRDISRI
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccgtggttcagaaattttatccagctctccgccactttcagtaaacagtcgccgtcg
tcgtcgccgcgcagagcagcggcggcgatattcgttactcgttcgccgtcactcacccag
ttgttgcggcatttcagcacccaccctcaagagaagtatcccggtctggggcccacgaag
ggggacgagaagccaagagtggtggttctgggttcgggttgggccgggtgcaggctcatc
aaggatattgataccaagatttatgatgttgtctgtgtctcacccagaaatcacatggtg
ttcactccactcctcgcttccacttgtgtaggaacgcttgagttccggtcggttgctgag
ccgatcgggaggatccagcccgccatttcgagagaacccggttcttatttcttcttggct
aattgtactggggttgacttccagaatcaccaggttcactgccaaactgtcactgaaggt
gtggaaaccttagatccatggaacttcaaagttgcatacgacaagctagtaattgcttct
ggagcacaggcttctacatttggaattaagggtgcaaatgaacatgcaacctttcttcgt
gaagttcatcatgctcaggagatcaggaggaaactgctgctaaatctgatgctgtcagat
gtgccaggaataactgatgaagagaagcgtaggcttctgcattgtgttgttgttggaggt
ggtcccacaggagttgagttcagtggagaacttagtgactttatacagaaggatgttcat
caaagatacgcacatgtgaaagattatattcatgttactctggttgaggcaaatgagatt
ctatcatccttcgatgatcgcctcagaaaatatgcaattaagcaattgaccaagtcagga
gttcgtcttgtccgtggaattgtgaaggatgtccaagctgaaaagataattcttagcgac
gatactgagattccatatggtgttttagtgtggtccacaggggttggtccttcagcattc
gtgaattccctggaaattcctaaagcacctggcggaaggattggcattgatgaatggcaa
cgtgtcccttctgtccaggacgtgtttgcaattggtgactgcagtgggtttcttgaaaat
actggcaggcccgttctaccagccttagcccaggtggcagaacgacagggaaaatatctt
gcaaaactgttgaaccacttaggcaaggccggtggtggacgtgctgatgctgcaaaagag
ttggattttgggagcccgtttgtgtataggcatttggggagcatggctaccattgggagg
tacaaggcccttgttgacctcaggcagagcaaggaaggaaaaggtctgtcgctggccgga
ttcgtcagctggttcatttggcgctcggcatatctcactcgtgtcgtaagctggaggaac
cgattttacgtagccatcaactggttgacgacttttgtgtttggtcgtgatataagtcgg
atatag

DBGET integrated database retrieval system