KEGG   Sesamum indicum (sesame): 105171206Help
Entry
105171206         CDS       T04135                                 

Definition
(RefSeq) cyclin-dependent kinase C-1
  KO
K08819  cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
sind  Sesamum indicum (sesame)
Brite
KEGG Orthology (KO) [BR:sind00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sind01001]
    105171206
Enzymes [BR:sind01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     105171206
    2.7.11.23  [RNA-polymerase]-subunit kinase
     105171206
Protein kinases [BR:sind01001]
 Serine/threonine kinases: CMGC group
  CDK family
   105171206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 105171206
NCBI-ProteinID: XP_011090543
Position
LG9
AA seq 512 aa AA seqDB search
MAAAAANNQLNVEEWPSWGSRSVECFEKLEQIGEGTYGQVYMAREKKSGEIVALKKIRMD
NEKEGFPITAIREIKILKKLHHENVIKLKEIVTSPGRESNEQGKPDCNKYKGNIYMVFEY
MDHDLTGLADRPGLRFTVPQIKCYMKQLLTGLHYCHVNQVLHRDIKGSNLLIDNEGNLKL
ADFGLARSFSNDINANLTNRVITLWYRPPELLLGATKYGPAVDMWSVGCIFAELLYGKPI
LPGKNEPEQLNKIFELCGTPDELSWPGVSKIPWYNKFKPSRQMKKRIRELFRHFDRHALD
LLEKMLVLDPAQRISAKDALDAEYFWTDPLPCDPKSLPKYESSHEFQTKKKRQQQRQNEE
LAKRQKLQHPQQHARLPPIQTGQPHPQHWNGPGQQMGNSQPPLPGVPSHHQYGKPRGPPG
GPSRYPPGGAAGGYYQDRGGQSGGYNSGPFPPQGRGPPLYPGNSAPSNAPRGTGGGYGAP
PNYSQSGQYGVSGGRGPNPQGGNRNQQYGWQQ
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggctgcaaataatcagctgaatgtggaggagtggccgtcgtggggctct
cggagcgttgaatgctttgaaaaactcgagcagattggggaaggaacctacggtcaagta
tacatggccagagaaaagaaaagtggagaaattgttgctttaaaaaagatacgcatggat
aatgaaaaagaagggttcccgattactgccatccgagaaattaaaattctaaagaagcta
catcatgaaaatgttattaaattgaaagagatagtgacatctcctggccgtgaaagcaat
gagcaaggaaagcctgattgtaataaatacaagggaaacatttacatggtctttgagtac
atggaccatgacttgactggccttgcagatcgtcctggactgagatttacagttccacaa
ataaaatgttacatgaagcaactgctcacgggtcttcattattgtcatgtaaatcaagtg
cttcacagggacataaaagggtctaatcttctaattgacaacgagggaaatctgaagctt
gctgactttggacttgcacgttccttttccaacgacatcaatgccaatcttacaaatcgg
gttattactttgtggtacagacctccagagttgcttcttggagccactaagtatggtcca
gctgttgacatgtggtctgttggttgtatctttgctgagctattgtatggaaaaccgatc
ttacccggaaaaaatgagcctgaacagttgaataaaatatttgagctttgtggaacccct
gatgagttatcgtggcctggtgtttcaaagattccatggtataacaaatttaagccatca
cgtcaaatgaaaaagcgaattcgggagctctttagacattttgaccgacatgctttggat
ttgttggagaaaatgctggttcttgatccagctcagagaatttcagcaaaggatgctcta
gatgctgaatatttctggactgatcccttaccttgcgacccaaaaagtttgccaaaatat
gaatcctcacatgagttccagacgaagaaaaaaagacagcagcagcggcaaaatgaagaa
ctggcaaaaagacagaagttgcagcatccacagcaacatgcacgcttgcctccaattcaa
accggacaacctcatcctcaacactggaatggccctggccagcaaatgggcaattctcag
ccgcctctgcctggtgtgcctagtcatcatcagtatggaaagcctcgtggtcctcctggg
gggcccagtagatacccaccgggaggggctgctggtggatattatcaagatcgtggaggt
caaagtggtggttataatagcggtccgtttccacctcaggggcgaggaccacctctttat
cctggaaatagtgctccttcaaacgctccccgaggaactggtggtggatatggagcacct
cctaattattcccaaagtggtcaatacggggtttctggcggcaggggtccaaatccacaa
ggtggtaacagaaatcagcagtacggttggcagcaatag

DBGET integrated database retrieval system