KEGG   Sesamum indicum (sesame): 105171269Help
Entry
105171269         CDS       T04135                                 

Definition
(RefSeq) probable protein S-acyltransferase 14
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
sind  Sesamum indicum (sesame)
Brite
KEGG Orthology (KO) [BR:sind00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sind04131]
    105171269
Enzymes [BR:sind01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     105171269
Membrane trafficking [BR:sind04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    105171269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 105171269
NCBI-ProteinID: XP_011090630
Position
LG1
AA seq 302 aa AA seqDB search
MYRSGAVMAWNVFKFCTALRGLGSIMILLVLGIVGVSYYAVVITSYGPGLAAGGLDSLLA
FVVLVLFHCLLVMLLWSYFSVVFTDPGGVPPNWRPAVDEERGDSDPLTGTEFQADSENGR
IRFCRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTL
VTLSLLPHFIAFFSDGDIPGTPGSLATTFLAFVLNLAFALSVMGFLIMHISLVTANTTTI
EAYEKKTTPKWRYDLGRRRNFEQVFGMDKKYWFIPAYSEEDLRRIPALQGLEYPSKPDLD
AQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtatagatctggagcggtgatggcctggaacgtgttcaagttctgcacggctctgagg
gggctagggtcgatcatgatactgttggttctcggcatcgtcggcgtcagctattatgcg
gtggtgatcaccagttacggccctgggctcgctgccggcggccttgactcgctcctcgcc
ttcgtagttttggtcttgtttcattgtctgttagtgatgctattatggagttatttttca
gttgtatttacggacccgggtggtgtgcctccaaattggcggccagccgtagatgaagaa
agaggagatagtgacccattgactggaactgaatttcaagctgactcagagaatggtaga
atccgtttttgtagaaagtgcaaccagttaaaaccaccccgctgtcatcactgctctgtt
tgtgggaggtgcatactgaagatggaccatcattgtgtttgggttgtcaattgtgttggg
gcattgaactacaagtattttcttctcttcctgttctacacattcctcgaaactactctt
gttacgctatcattactgccgcattttattgcattctttagtgacggagatatccctggg
actccaggaagtcttgcaaccacttttcttgcctttgtgttgaatttggcattcgctttg
agcgtaatggggttcctgattatgcacatatcactggtgactgccaacaccacaaccatc
gaggcttatgagaagaagactactccaaaatggcgttatgatcttggacggaggagaaac
tttgagcaggtgttcgggatggataagaagtactggtttatcccagcttactcagaagaa
gatttacgacgaattcctgcccttcagggtcttgaatatccttcaaagcctgacctggat
gctcaataa

DBGET integrated database retrieval system