KEGG   Sesamum indicum (sesame): 105173230Help
Entry
105173230         CDS       T04135                                 

Definition
(RefSeq) glutathione S-transferase zeta class-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00350  Tyrosine metabolism
sind01100  Metabolic pathways
Module
sind_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    105173230
Enzymes [BR:sind01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     105173230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-GeneID: 105173230
NCBI-ProteinID: XP_011093214
Position
LG11
AA seq 399 aa AA seqDB search
MFHHRQLQSICRVAATNPGILHSITTVSSIGTESQLLNSYTVTPPIKPWPQKLTHKRLCS
IITNQQNLDLALQIFHYAGNYHPNFHHSYETYHAIIHKLSRQRAFEPISSLLNELRNSRI
KCGENLFITLIRYYGIASRPKEAIKIFLRINDFGVKSWGASAANIFTSPSSMEPNKQRHS
PVDSSSAPKLVLYSYWQSSCSWRVRFGLNLKGLSYEYRAVNLAKGEQFTSEFGKVNPLRY
VPVLVDGDVVVSDSYAILLCLEEKYPQKPLLPADPQLRAINLQAASIVSSSIQPLHMLSL
LKYVEEKVGPEEQQAWAHVHIEKGFLALEKLLKDCAGPYATGEEVFLADVFLAPQIAVAT
KRFNVDMSKFPTLRTVYESCNALPEFQASLPDRQPDAVQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgttccatcaccggcaacttcaatccatctgccgcgtcgccgccacaaaccctggaatc
ttgcactctatcaccaccgtctcctcaataggaaccgaatcccaactcctcaattcctac
accgtcacaccaccaatcaaaccctggccccaaaaactcacccacaaacgcctctgctcc
atcatcaccaaccagcaaaatctcgatcttgctctccaaattttccactatgccggcaat
taccaccctaattttcaccacagttacgagacctaccacgccattatccacaagctctcc
cgccagcgcgcattcgaacccatatcctcccttttgaatgaattgcgaaattcgcgaatc
aaatgcggcgaaaatttatttatcactcttattcggtactacggtattgccagtagaccg
aaagaggcgatcaaaatattccttcgaattaatgattttggtgttaaaagttggggtgct
tctgctgctaatatcttcacttctccatcatcaatggagcccaacaagcagaggcatagt
ccagttgattcttcatcagctccgaaacttgtactctactcttactggcagagctcttgc
tcttggcgtgtgcgctttgggttgaatcttaaaggactttcttatgagtacagagctgtc
aatcttgcgaaaggggaacagttcacttcagagtttgggaaagtaaatcctcttcgatac
gtcccagttttggttgacggggatgtagttgtttcagactcatatgcaattctactgtgt
ttagaagagaagtatcctcagaaaccacttttaccggctgatcctcaactaagagcaatc
aatctccaggctgctagtattgtgtcttccagcatacagcctcttcacatgttatcgctg
ctgaagtatgtcgaggaaaaagtgggtcctgaagagcaacaagcatgggcacatgtccat
atagaaaagggcttccttgctcttgagaagctactaaaagattgtgccggcccatatgct
acaggagaagaagtttttttggctgacgtattcttggcccctcaaattgcggtagctaca
aagcggtttaatgtcgatatgtccaagttcccgactctgcgtacggtatacgagtcgtgc
aatgcattgcctgaattccaagcttctttgcctgatagacaacctgatgctgtgcagtga

DBGET integrated database retrieval system