KEGG   Sesamum indicum (sesame): 105173628Help
Entry
105173628         CDS       T04135                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sind00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105173628
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sind03041]
    105173628
Enzymes [BR:sind01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     105173628
Spliceosome [BR:sind03041]
 Complex C
  Other components
   Step II factors
    105173628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 ABC_tran T2SSE Flavi_DEAD AAA_14 AAA_16 Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 105173628
NCBI-ProteinID: XP_011093749
Position
LG11
AA seq 1208 aa AA seqDB search
MGAEIEADGLKKLEYLSLVSKVCSELETHLGFGDKVLAEFITEMGRNCEKVDEFDAKLKE
NGAEMPDYFVRTLLTIIHAILPPKQKSKSEKGSKEGEKTPFAALKIKDGKERVKDLEKEI
EEEAKSRRRIEEEDEEDKYRDRGRDSDRRERRDRGKDRERGRYGDREERGRYGDREERGR
HGVREERGRHGDREERGRYDRDGYEDDKGRRRNSDRDRNKDEQNWRNGYEEEMDDDRRET
RKERSKRPEEPELYKVYKGRVSRVMDKGCFVQFHEFRGKEGLVHVSQMATRRITNAKDVV
KRDQEVYVKVISVSGNNLSLSMRDVDQNSGKDLLPLKRSEVDDGLRTNPSGRNEGGGMGS
RIGLSGIKILEEDEAVPSRRPLKRMSSPERWEAKQLIASGVMSVKEYPMFDEDGDGMLYQ
EEGAEEELEIELNEDEPAFLQGQSRYSIDMSPVKIFKNPEGSLSRAAALQSALIKERREV
REQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAYGKALTF
GQRSKLSIQEQRQSLPIYKLKNELVKACHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTK
GKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTSPETVIKYMTDGMLLREI
LIDEDLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLIVTSATLDAEKFSGYFF
NCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDYAC
QCLYERMKGLGRNVPELIILPVYSALPSEMQSRIFEPAPPGKRKVVVATNIAEASLTIDG
IFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAFHN
EMSPTSIPEIQRINLGMTTLNLKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEE
GLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQ
KRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYK
LDVVSAGKNFSKIRKAIAAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVI
YHELVMTTKEYMREVTVIDPKWLVELAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNS
WRLSKRRA
NT seq 3627 nt NT seq  +upstreamnt  +downstreamnt
atgggggcagaaattgaagcagatggactgaagaagctggagtacctatctctagtctcc
aaagtgtgttccgagttagagactcatctagggtttggtgataaggtgttggctgagttc
atcacggagatgggtcggaattgtgagaaagtggacgaattcgatgccaaactgaaggag
aatggtgcagagatgccggattattttgtgcggacgctgctcactattattcatgcgatt
ttgccgccgaagcagaaatcgaaatcggagaaggggtcgaaggagggagagaaaacccca
tttgcagctttgaagatcaaggatggtaaggagagggtgaaggatttggagaaggagatt
gaggaggaagctaaaagccggaggagaatagaggaagaggatgaggaagacaagtatagg
gatagagggagggatagtgacagaagagagagaagggacagagggaaggacagggaaagg
ggtagatatggggatagagaggaaaggggcagatatggggatagagaggaaaggggcaga
catggggtaagagaggaaagaggtagacatggggatagagaggaaaggggcagatacgat
agggatggatatgaagatgataaaggtagacgaagaaacagtgacagggacagaaataaa
gatgaacagaattggaggaatgggtatgaggaagagatggatgatgacaggagggagacg
aggaaggagaggagtaaacggccggaggagccagaattgtataaagtttacaagggaagg
gtttcaagggtgatggataagggatgttttgttcaatttcatgaatttagagggaaagaa
ggtctggtacatgtgtctcagatggcaactaggaggattacaaatgcaaaggatgtagtg
aagcgagatcaggaagtctacgtgaaagttatctcggttagtgggaataatctgagtttg
tcaatgagggatgtggatcagaacagtggaaaggatttgttgcccttgaagaggagtgag
gtggatgatggtttgagaacgaacccttcaggtaggaatgaaggtggagggatggggagt
aggattggtctatcggggatcaaaattctcgaggaagatgaagctgtgccatcacgaaga
ccactgaagagaatgagttcgccagaaaggtgggaggctaagcagctgattgcttctggt
gttatgagcgtaaaggagtatcctatgtttgatgaagacggagatgggatgctttatcag
gaggaaggagcagaagaggagctagagattgaattgaatgaggatgaacctgcttttttg
cagggtcagagtaggtactccattgacatgtctcctgtaaagatattcaagaaccccgag
gggtctttgagtcgtgcagcagcacttcagtctgctctgataaaggagaggagggaagtt
agggaacaacaacaacgaacaatgttggattccatcccaaaggatctgaatcgaccgtgg
gaagatccaatgccagaaacaggtgagaggcatcttgctcaggaactgagaggtgttggt
ttgtctgcatatgacatgccagagtggaaaaaggatgcgtatggtaaagctttaactttt
ggacagagatcaaagctatccatacaggaacagagacaaagcttgcccatctataagttg
aagaatgaactggttaaggcttgccatgataatcaggtcctggttgtcattggtgagaca
gggtcaggtaagacgacacaggtaacacagtatcttgctgaagctggatatactactaaa
ggcaaaataggatgtactcaacctcgtagagtggctgcaatgtctgtggccaagagagtt
gctgaggaatttggttgtcgtttaggggaagaagttggctatgcaattcgttttgaggat
tgtactagtccagagacagtaatcaagtatatgaccgatggtatgcttcttagggagatt
ctgattgatgaagatttgtctcagtactcagtgataatgcttgatgaggctcatgaaagg
acaattcacacagatgtcctttttggattactgaagcaacttgtgaaacggagacctgat
cttcgtctcattgtcacatccgcaactttagatgcagaaaagttttctggatatttcttc
aattgcaacatcttcactattcccgggagaacatttcctgtagaaatactctacaccaag
cagccagaaagtgactacttggacgcatcactgatcactgtattacagattcacttgact
gaacctgaaggtgatatacttctgttcttgactggtcaagaagagatcgattatgcatgt
caatgcctttatgagaggatgaagggtttaggtagaaatgttcccgagttgattatttta
cctgtgtacagtgccttacctagtgaaatgcagtccaggatttttgagcctgcacctcct
ggaaaaagaaaagtagttgttgctacaaatattgctgaagcttctttgactattgatggc
atattctatgtgattgatcctgggtttgcaaagcaaaatgtctacaatcctaaacagggg
cttgattcactggtgataactccaatatcacaagcatctgcaaagcaaagggcaggacga
gctgggcgaacaggaccaggaaagtgctatcgtctctatacagagagtgcatttcacaat
gagatgtctcccacttcaattccagagatacagaggattaatctcggaatgactactctt
aatttgaaagctatgggtattaatgacctattatcttttgattttatggaccctccttca
ccgcaggcacttatatcagccatggaacagttatacagtttaggagctctggatgaagag
ggtctccttaccaagttgggtaggaaaatggcagaatttcctctagatccgccactgtcc
aaaatgcttcttgccagtgtagatctcggttgcagtgatgagattctgaccatcattgca
atgattcagactggaaatatattctatcgaccaagagaaaaacaggctcaggcagaccag
aaaagagcaaagttttttcagcctgaaggagaccatttgacactacttgctgtttatgag
gcgtggaaagcaaagaatttctcaggtccatggtgctttgagaattttgttcagtctcga
tcattgagaagggcgcaggatgtgagaaaacagcttctctccatcatggacaagtacaag
ttggatgttgtaagtgctggtaagaacttttcaaagattcggaaagctatagctgctggt
ttctttttccatgctgctagaaaggatccacaagaaggctacagaacgctagtcgagaac
cagccagtttatatacatccaagcagtgctttgttccaaagacaacctgactgggttatt
taccacgaattggtgatgaccactaaggagtatatgcgtgaggtcacagttatagatccc
aagtggcttgttgaactagctccaagattcttcaaggtctcagatcctacaaaaatgagc
aagcgtaagagacaagagcgtattgagccactctatgacagatatcatgaaccaaattct
tggcgtttgagcaaaaggcgtgcttag

DBGET integrated database retrieval system