KEGG   Sesamum indicum (sesame): 105174121
Entry
105174121         CDS       T04135                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00100  Steroid biosynthesis
sind01100  Metabolic pathways
sind01110  Biosynthesis of secondary metabolites
Module
sind_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    105174121
Enzymes [BR:sind01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     105174121
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 105174121
NCBI-ProteinID: XP_011094420
UniProt: A0A6I9U5G3
Position
LG11
AA seq 369 aa
MDLNALLQAFTPSWTSVVMLVVFFTYLAIAGSILPGRVVPGATLADGTRLHYRCNGLLSL
LLLVCLLGISGWMNLVSPTAIADRGLELLSTTLIFSALVTFLLYMAGCRSRDQSSSLKPH
ISGNLIHDWWFGIQLNPQFIGIDLKFYFVRAGMMGWLLINLSVLAKCILETNLSRSMILY
QLFCVLYILDYFFYEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLNNEVQLT
TAAIIANCLVFLIGYLVFRGANKQKHVFKKNPKALIWGRPPKVIGGKLLASGYWGIARHS
NYLGDLLLALSFSLPCGISSPVPYFYPIYLFILLIWRERRDEARCAQKYKEIWAEYKKEV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctcaacgctcttcttcaagcattcactccttcatggacttcggtagtcatgcta
gtggtgtttttcacttatctggcaatcgctggatctattttgccgggaagagttgttccc
ggagccactttagcagatggaactcggctccattaccgttgcaacggattactatcgctt
ctcttgttggtttgcctacttggaatcagcggttggatgaatcttgtatcacccactgca
attgctgatagaggtcttgagcttttatccacaacacttatattcagtgcacttgtgaca
tttcttctttacatggctggctgcagatcccgtgatcaaagttcttctttaaagcctcac
attagtggaaacttaatccatgactggtggttcgggatacagctgaatcctcagttcata
ggaattgacctcaagttctactttgttagagctggtatgatgggatggcttcttataaat
ctttctgttcttgcaaaatgcattctagaaaccaacttaagcagatcgatgattctttac
cagctattttgtgttctatacattctggactactttttctatgaagagtacatgacctcc
acatgggacataattgctgagagattggggttcatgctggtgtttggagatctagtctgg
atcccattcacatttagtatccagggttggtggcttctaaataatgaagtgcagctaaca
actgctgctattattgcaaactgtctcgtcttcctgattggctatcttgtctttagagga
gctaacaagcagaagcatgtgttcaaaaagaatcccaaagcactaatttggggtagacct
ccgaaggtcattgggggaaagttgcttgcttctggctattggggcattgcaaggcatagt
aactatcttggagacttgttgctggctctgtccttcagtttaccttgtgggataagttct
ccagttccatatttctatcctatatacctcttcattctactaatatggagagagagaaga
gatgaagcccggtgtgcacagaagtacaaagaaatttgggcagaatacaagaaagaggtt
ccttggaggatacttccatatgtttattag

DBGET integrated database retrieval system