KEGG   Sesamum indicum (sesame): 105174133
Entry
105174133         CDS       T04135                                 

Definition
(RefSeq) cytochrome P450 76A1-like
  KO
K20618  nepetalactol monooxygenase [EC:1.14.14.161]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00902  Monoterpenoid biosynthesis
sind01100  Metabolic pathways
sind01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    105174133
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sind00199]
    105174133
Enzymes [BR:sind01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.161  nepetalactol monooxygenase
     105174133
Cytochrome P450 [BR:sind00199]
 Cytochrome P450, plant type
  CYP76 family
   105174133
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105174133
NCBI-ProteinID: XP_011094434
UniProt: A0A6I9U9M2
Position
LG11
AA seq 511 aa
MEWALTSINPLAISIFAGLLLLVLFLRPKNSGKKPPGPKGVPIFGNLLQLGDLPHETMHK
WKQTYGPVIWLKLGSVYTMVVQDAASASELFKKHDLPFADRKVPDVLTAYDFNQGTLGMN
QFGGHWRVLRRLCSMEFLVNKRMNETTELRHRIRENMERWILEESAAARAQGGTGAIQLS
RFLFLLAFNLVGNLMLSRDLLDAKDPESREFFDCMNKVLELAGTPNIADYLPYLKWMDPA
GMKRNMTKNLGRTMKISSKFIQERLNNRKAGKFQEKKDFLDVLLEYEGDGKDGPDRITEK
NINIIITEMFFAGSETTSISIEWGFAELLRSPHTFKKLREELDRVVGVNRRVEEKDVENM
PYLQAVVKETLRLHPALPLLLPRNTMENTNYLGYDIPKGTQVFVNAWGIGRDPKCWEDPL
AFKPERFLQSNVEYKGQHFELIPFGSGRRICVGFPLAHRVVHLTLATLVQSFDWDLGPGV
KPEDIDREERLGLTLRKKNPLFIIPKKRLNI
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggagtgggctctcacttcaatcaatccactcgccatttccatattcgccggtcttctt
cttctggtactgttcttgaggcccaagaactccggcaagaagcctccaggcccgaaagga
gtgcccattttcggcaacctgcttcagctgggggatctgccccatgagactatgcacaag
tggaaacaaacctatggccccgtcatctggctcaagctcggctcagtctacacaatggtg
gttcaggacgctgcctccgcttctgagctcttcaagaagcacgaccttccgttcgctgac
cggaaggtgcctgacgtgctgacagcctatgatttcaaccagggaactctgggaatgaac
cagtttggcggacactggcgggtgctcaggcggctttgctctatggagttcttggtgaac
aagcgcatgaacgagacgacggagctccggcatcggatcagggagaatatggagaggtgg
atcctggaagagtcggctgcggcgcgggctcagggcggcaccggcgccatccagctcagc
aggtttctcttccttttggcttttaacctggtggggaacctgatgctctccagggatttg
cttgacgcaaaggaccctgagtcacgggaattctttgactgcatgaataaggttctggag
ctagcagggacgcctaacatcgctgactacttgccctacttgaaatggatggacccggcg
ggcatgaagcggaatatgaccaagaatttgggccgcaccatgaaaatctcttccaagttc
atccaggaaaggctcaacaacagaaaggcaggtaagttccaggagaagaaagactttctt
gatgtgttgttggagtacgagggcgatggaaaagatggacctgacaggatcactgagaag
aatatcaacattattatcaccgaaatgttcttcgctggatctgagaccacaagtatcagc
atagaatggggatttgcggagctcctgcgcagccctcacaccttcaagaagctaagagaa
gaactcgacagggtggtgggagtgaaccggcgggtcgaagagaaggacgtcgaaaacatg
ccatatctccaagctgtagtaaaagaaacactacgactgcaccccgctttgccattgctg
ctgccgaggaacaccatggagaacaccaattacctgggatacgatatcccgaagggaacc
caggttttcgtgaacgcctggggaatcgggcgtgaccccaagtgctgggaggacccccta
gccttcaagcctgaaaggttcctgcaatccaatgttgagtacaaggggcagcatttcgag
ctgattccattcgggtcaggccgcaggatttgcgtcgggttcccgttggctcatcgcgtg
gttcacctgaccctggctactttagtccagtctttcgactgggatctcgggccgggagtg
aagcccgaagacattgatagagaggagaggctgggattgacactgaggaagaagaatcca
ctcttcattatccccaagaaacgcttaaacatttga

DBGET integrated database retrieval system