KEGG   Sesamum indicum (sesame): 105175117Help
Entry
105175117         CDS       T04135                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial isoform X1
  KO
K17761  succinate-semialdehyde dehydrogenase, mitochondrial [EC:1.2.1.24]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00250  Alanine, aspartate and glutamate metabolism
sind00650  Butanoate metabolism
sind01100  Metabolic pathways
Module
sind_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    105175117
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105175117
Enzymes [BR:sind01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     105175117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 105175117
NCBI-ProteinID: XP_011095760
Position
LG12
AA seq 532 aa AA seqDB search
MGWTRTGMAFHRYSLSFLSPRLSAHPLPRSLSATISSHQMSTDAQSVAARLNSAGFIRSQ
GFIGGKWTDAYDGKTIEVTNPATGEVITNVSCMGGRETNDAIASAQDAFVSWSKQTAAER
SKCLRKWYDLIMAHKEELGQLMTLEQGKPLKEAIGEVSYGASFVEFYAEEAKRIYGDIIP
ATLPDRRLFVLKQPVGVVGAITPWNFPLAMITRKVAPALACGCTVVIKPSELTPLTALAA
AELSIQAGIPPGAVNVVMGNASDIGEALLASPQVRKITFTGSTAVGKKLMAGAASTVKKV
SLELGGNAPCIIFDDADLDVALKGTLATKFRNSGQTCVCANRILVQEGIYDKFANAFSNA
VSSMKVGDGFGEGVVQGPLINDAAVHKVESFLQDAISKGAKVLIGGKRHSLGMTFFEPTV
ITDVKSEMLLSREEVFGPIAPLLKFKTEEEAIRMANDTNAGLAAYIFTSSIKRSWRVSEA
LEYGLVGVNEGLISTEVAPFGGVKQSGLGREGSKYGMDEYLEIKYICLGNMS
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggggtggacacgcacaggcatggcgtttcatcgttactcactcagctttctctctcct
cgtctctctgcacatcctctaccacgctccctctctgctactatatcttctcatcagatg
agtacggacgcacagagtgttgctgcccgtctaaacagtgcagggtttatccggagtcaa
ggttttataggagggaaatggactgatgcatatgatgggaagactattgaggtcactaat
cctgctacaggtgaggttataacaaacgtgtcatgcatgggtggaagggagacaaatgat
gcgattgcttcagcacaagatgcatttgtttcttggagcaagcaaactgctgctgaaagg
agcaagtgtttacgaaaatggtatgatttgataatggcccacaaagaagagcttggacaa
cttatgaccctagagcaaggaaaacctctaaaagaggctattggtgaggttagctatgga
gcaagttttgtagagttctatgctgaagaagctaaacgaatttatggtgatatcattcct
gcaacattaccagatcgtcgtttgtttgttttgaagcagccagttggcgttgttggggca
attactccctggaactttcctctggccatgattacgcgcaaggtcgcccctgcccttgct
tgtggatgcactgttgtcataaaaccctctgaactgacgccattgactgcattagcagca
gctgaactctccattcaagcaggaataccaccgggtgcagtcaatgttgtaatgggaaat
gcatctgatattggagaagctttacttgcaagtccccaggtaaggaagatcactttcaca
ggctcaacagctgttggaaaaaagttgatggcaggcgctgcaagcactgtaaaaaaggtg
tcccttgagctgggtggcaatgcaccctgcataattttcgatgatgcagatcttgacgta
gctttgaaaggaactctggcaactaaattccgcaacagtggacaaacatgtgtttgtgca
aatagaatacttgtgcaagaaggcatatatgacaagtttgcaaatgctttttcaaatgcc
gttagcagtatgaaggtgggggatggctttggcgaaggtgtggtacaggggcctctaatt
aatgatgctgcagtgcacaaggttgaatcattcttgcaagatgccatctcaaagggagct
aaagtcctcatcggcggcaagagacatagccttggaatgactttctttgagcctacggtg
ataactgatgtcaaaagtgagatgcttttatcaagagaggaggtatttgggccaattgca
cctcttctgaaatttaagactgaggaagaagctatccgcatggccaatgacaccaatgca
ggtctggctgcatacatctttacatcaagcattaagcgttcgtggcgtgtctctgaagct
cttgaatatggattggttggagttaatgaaggactaatttcaacagaggtggctccattt
ggaggcgtgaagcaatcaggtcttggtcgtgaaggatcaaaatacgggatggatgagtat
ctggaaattaagtatatatgcttgggaaatatgagctga

DBGET integrated database retrieval system