KEGG   Sesamum indicum (sesame): 105175135Help
Entry
105175135         CDS       T04135                                 

Definition
(RefSeq) germacrene-D synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    105175135
Enzymes [BR:sind01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     105175135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth LAGLIDADG_1
Motif
Other DBs
NCBI-GeneID: 105175135
NCBI-ProteinID: XP_020554144
Position
LG12
AA seq 554 aa AA seqDB search
MEFDSTHSSILIKKVDQDDVRRSVKYHPSVWGDYFLAYVSMEISATEEEELRRQKEMVRK
VLARTPDHLYHKLELIDAIQRLGVGYHFEEEIDKFLQFTHDTYLEYSSKANDLRIVALRF
RLLRQHGYPVSCDIFNKFIDGEGNFKVSLIKNVEGMLELFEAAQFRIAGEKILEKALEFS
SSNLESSLSNMNSSLSTQVKEALKIPILKSSNRVGAKKFISIYQQNVSHSEILLNFAKLD
FNIIQKTHQKELSDITRWWKDLDFANKLPFARDRVVECYFWAVEVYFEPHYHIARKMLTK
IINMTSILDDIYDVYGTLDDLQLFTDLIQRWDVHALEQLPSYMRICYEALSDVYIEMENE
LKKTDGSYRIQYAKEEMKKLVRAYLEEAKWSYNKDMPRMEEYMKVASVTSAYMMLLTTSL
VGMGNLVTKKDFDWITSEPLLLLAFSTICRLTNDLVGYGFEKKPTAVECYMNENGASKEE
AFAELQEQVTKAWKDMNQESLRPTVSISMPVLTRVLNFTRIPHLFYVEDDEYTNSEANIR
SIIYSILVEANVTI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgattctacacattcttcaattttgattaagaaagttgatcaagacgatgtt
cgtcgatcagtcaaatatcatcctagcgtttggggagattatttcttggcttatgtttct
atggaaatttctgctaccgaagaggaagaacttcgaagacaaaaggaaatggtgcggaag
gtgttggcccggacgccagatcatttgtatcacaaattagaactcattgatgcaattcaa
cgccttggcgttggttatcattttgaagaagaaatcgacaaattcttacagttcacacac
gacacttacttagagtatagtagcaaagccaatgatcttcgtattgttgctcttcgattt
cgtttactcagacaacatggctatcctgtctcatgtgacattttcaacaaattcatagac
ggtgaagggaatttcaaggtatcactgataaaaaatgtcgaagggatgttagagttattt
gaggcagcacaattcagaatagctggggagaaaattcttgagaaagcattggagttctcc
tcctccaatcttgagtcttcactctcaaacatgaacagttctctttcgacacaagttaaa
gaagccctgaagatcccaattctcaagagttctaacagagtgggagctaagaaattcatt
tccatataccaacaaaatgtatcacattctgagatactattgaattttgcaaaattggac
tttaacattatacaaaagacgcatcagaaagagctcagcgatattacaaggtggtggaag
gatttagattttgcaaataaattgccttttgcaagagatagggtggtggaatgctacttt
tgggcagtggaagtctactttgagcctcattaccatattgcaagaaaaatgctaaccaaa
atcatcaacatgacttccattcttgacgacatttatgatgtttatggaacattagatgat
cttcagctttttacagatctcattcaaagatgggatgtccatgccttggagcagttgccg
tcatacatgagaatatgttatgaagccctttcagatgtgtatattgaaatggaaaatgaa
ttgaaaaaaacagacggatcatatcgtatccaatatgcaaaagaagagatgaaaaaattg
gtgagggcatacttagaagaggcaaaatggtcttacaataaggatatgccgaggatggag
gaatatatgaaggtggccagcgtaacttctgcttatatgatgttgttaacaacatccttg
gtcggtatgggaaacctagtaactaaaaaagattttgactggattacaagtgagccactg
cttcttcttgcattctcaacaatttgcagattaaccaacgacttggtaggatatgggttt
gaaaagaaacccaccgcagttgaatgttacatgaatgaaaatggtgcctcaaaggaggaa
gcttttgctgaactccaagaacaagtcacaaaagcatggaaggacatgaatcaagaaagt
cttcgaccaacagtatcgatttctatgccggtcctaacacgtgttctcaattttacgcgc
attccacatcttttctatgtggaagacgatgaatataccaattccgaagctaatataaga
agtattatatacagcatactagttgaggcgaacgtgacaatttaa

DBGET integrated database retrieval system