KEGG   Sesamum indicum (sesame): 105175765Help
Entry
105175765         CDS       T04135                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00350  Tyrosine metabolism
sind00360  Phenylalanine metabolism
sind00380  Tryptophan metabolism
sind00901  Indole alkaloid biosynthesis
sind00950  Isoquinoline alkaloid biosynthesis
sind00965  Betalain biosynthesis
sind01100  Metabolic pathways
sind01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    105175765
   00360 Phenylalanine metabolism
    105175765
   00380 Tryptophan metabolism
    105175765
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    105175765
   00950 Isoquinoline alkaloid biosynthesis
    105175765
   00965 Betalain biosynthesis
    105175765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sind04147]
    105175765
Enzymes [BR:sind01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     105175765
    4.1.1.105  L-tryptophan decarboxylase
     105175765
Exosome [BR:sind04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105175765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase DUF4334
Motif
Other DBs
NCBI-GeneID: 105175765
NCBI-ProteinID: XP_011096642
Position
LG12
AA seq 507 aa AA seqDB search
MGSLQNQKPDNGFAGTIKPLDPEEFRRQGHLVIDFLADYYKSVERYPVRSQVEPGYLKKR
MPDSAPYDAEPIEDILRDVQKDIVPGITHWQSPNYFAYFPASGSIAGFLGEVLGTGFNIV
GFNWMSSPAATELETIVMDWLGKMLNLPSEFLFSGGGGGVLQGTTCEAILCTLVAARDQM
LKKIGRENINKLVVYGSDQTHSALQKAAQIAGINPSNFRAVATTRADAFGLTADALRATI
ESDVESGLVPLFLCPTIGTTSSTAVDPLGPLCDVAEEYGIWVHVDAAYAGSICICPEYRH
FLDGIEKAHSFSFNAHKWFLTTLDCCCLWVKDPGALIKALSTYPEYLRNKASETKQVVDY
KDWQITLSRRFRSLKLWLVIRSYGVANLRKFLRSHVKMAKNFEGLIGMDKRFEVVVPRNF
ATVCFRISPIEIGGNHQIVTKEDAANNFNAKLLESINESGKIYMTHAVIGGVYVMRFAVG
ASLTENKHVIWAWKVVQEHANALLTSS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtcttcagaatcagaaacctgacaatggcttcgccgggaccatcaaacctctg
gacccggaggagttcagaaggcaaggccatttagtcatcgactttcttgctgattattac
aagagtgttgagagatatcctgtccgcagtcaagtcgagcccggctatctcaagaaacga
atgcccgactccgctccctatgacgccgagcccattgaggatattcttcgggatgttcag
aaagatattgttcccggcataactcactggcagagtcccaactattttgcgtatttcccc
gccagtggtagcattgctggatttcttggggaagttcttggcaccgggtttaacattgtg
ggattcaactggatgtcgtcccccgctgccacggagctggaaaccatcgtcatggattgg
ctcggtaaaatgctcaaccttccttctgagtttctcttctccggcggaggtggtggtgtt
ttgcagggtaccacctgcgaggccatattgtgcacgctggtggccgccagggatcagatg
ctcaaaaagatcggcagggaaaatataaacaagttggttgtatacgggtcggatcaaacc
cactccgctttgcagaaggcagctcagattgcgggcatcaaccccagcaatttccgtgcc
gtcgccaccacaagggccgacgcattcgggctaactgctgatgccctccgcgcgacaatt
gaatcagatgttgaatccgggctggtgccgctgttcctgtgccccaccatcgggactacg
tcgtcaaccgcggtggatccattgggcccgctgtgcgatgtggcggaggagtatggaatc
tgggtgcacgtcgatgccgcgtacgccggaagcatttgcatttgccccgagtaccgccat
ttcctggacggcatcgagaaagcgcactctttcagcttcaacgcccacaaatggttcttg
acgacactggattgctgctgcctctgggttaaagaccccggcgccctgatcaaagctctg
tcgacatatccagaatatctgagaaacaaagcctcggagacaaagcaggtggtggactac
aaagactggcaaattactctcagccgccgcttccggtctctgaaactctggctcgttatc
cgcagctacggcgtcgcaaatctcaggaaattcctgcgtagtcacgtaaaaatggcgaag
aatttcgaagggctgatcggaatggacaagcgtttcgaggtggtggtgccgagaaacttt
gccaccgtctgcttccgcatatcgccgatcgaaatcggcggaaaccatcagatcgtgaca
aaggaggacgcagccaataatttcaatgccaagttgctggagtccataaacgaatcaggc
aagatttacatgacacacgcagtgattgggggagtttatgtgatgcgattcgctgtcggg
gcgagcctgacagaaaacaagcacgtcatttgggcctggaaagtggttcaggaacatgca
aatgccctgctaaccagctcctaa

DBGET integrated database retrieval system