KEGG   Sesamum indicum (sesame): 105175877Help
Entry
105175877         CDS       T04135                                 

Definition
(RefSeq) stromal 70 kDa heat shock-related protein, chloroplastic
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
sind  Sesamum indicum (sesame)
Pathway
sind03040  Spliceosome
sind04141  Protein processing in endoplasmic reticulum
sind04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sind00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105175877
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105175877
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105175877
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sind01009]
    105175877
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sind03041]
    105175877
   03009 Ribosome biogenesis [BR:sind03009]
    105175877
   03110 Chaperones and folding catalysts [BR:sind03110]
    105175877
   04131 Membrane trafficking [BR:sind04131]
    105175877
   03051 Proteasome [BR:sind03051]
    105175877
   03029 Mitochondrial biogenesis [BR:sind03029]
    105175877
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sind04147]
    105175877
Protein phosphatases and associated proteins [BR:sind01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     105175877
Spliceosome [BR:sind03041]
 Complex B
  Other components
   Prp19 complex
    105175877
 Complex C
   Prp19-CDC5 complex
    105175877
Ribosome biogenesis [BR:sind03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    105175877
Chaperones and folding catalysts [BR:sind03110]
 Heat shock proteins
  HSP70 / DNAK
   105175877
Membrane trafficking [BR:sind04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    105175877
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    105175877
Proteasome [BR:sind03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    105175877
Mitochondrial biogenesis [BR:sind03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    105175877
Exosome [BR:sind04147]
 Exosomal proteins
  Proteins found in most exosomes
   105175877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C FtsA LXG StbA PilM_2 Hydantoinase_A DUF5398 SRA1 HBM IFT57
Motif
Other DBs
NCBI-GeneID: 105175877
NCBI-ProteinID: XP_011096814
Position
LG2
AA seq 694 aa AA seqDB search
MATAAQLHCPFPQTGNKTPFLGLKTIKKTPFISLYRRKSNDHGSLRHKQHKPFRVVSEKV
VGIDLGTTNSAVAAMEGGQPTIITNAEGQRTTPSVVAYTKTGDRLVGQIAKRQAVVNPEN
TFFSVKRFIGRKMNEVDDESKQVSYKVVKDENGNVKLECPATGKLFAPEEISAQVLRKLV
DDASKFLNDKVAKAVITVPAYFNDSQRTATKDAGRIAGLDVLRIINEPTAASLAYGFEKK
NNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDWLADTFRKEEG
IDLLKDKQALQRLTETAEKAKIELSSLTQTNISLPFITATADGPKHIDTTLTRAKFEDLC
SDLLDRLKTPVENALRDANLSIKDIDEVILVGGSTRIPAVQELVRKMTGKDPNVTVNPDE
VVALGAAVQAGVLSGDVSDIVLLDVTPLSLGLETLGGVMTKIIPRNTTLPTSKSEVFSTA
ADGQTSVEINVLQGEREFVKDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVTAI
DKGTGKKQDITITGASTLPKDEVDRMVKDAERYAKEDKEKREAIDTKNQAESVMYQTEKQ
LKELGDKIPAAVKDKVESKLKELKDSISGGSTQAIKDAMTELNQEVMQMGQSLYSQPGAA
GAEHAGGATSDSGSTGKSSDGDGEVIDADFSESN
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggctactgcagcgcagctccactgtccatttccccaaacgggaaacaaaaccccgttt
ctgggcctgaaaacgatcaagaaaacgccgttcatttcactttacagaagaaaaagcaat
gatcatgggagtttgaggcataagcaacacaagccgtttagagtggtaagtgaaaaggtg
gtgggaattgacttgggcaccaccaactccgccgtggcggcgatggaaggtggccagccg
actatcataactaatgctgaggggcaacgtacgacgccgtctgtggtggcgtatacaaag
acaggtgacaggcttgttgggcagattgccaagagacaggcggtggtgaatcctgaaaac
acgtttttctcggtgaagaggtttattgggaggaagatgaatgaggttgatgatgagtct
aagcaggtttcgtataaggtggtgaaggatgagaatgggaatgtgaaactggagtgtccc
gctactggaaaattgtttgcacccgaggagatttctgctcaggtcttaagaaagcttgtg
gatgatgcctcaaagtttttgaatgataaggtcgctaaagcagttattactgtaccagcc
tattttaatgactcccaaagaactgcaacaaaagatgccggtcgtatagctggattggac
gtcctccgtattattaatgaacctactgctgcttctttggcttatgggttcgagaagaaa
aataatgaaaccattctagtttttgacctcggaggtggtacatttgacgtttcagttctt
gaggttggagatggagtttttgaggtgctttctacctcaggggacacacatctgggaggt
gatgattttgacaagaggattgtcgattggcttgctgacaccttcaggaaagaagagggt
attgatcttctcaaggacaagcaggctctccaacggcttactgaaactgctgagaaggca
aagatagaattgtcatctttaactcaaactaatataagtttaccttttatcactgctact
gcagatggtccaaaacatattgacactacattaacaagggctaaatttgaagatttatgc
tctgacttactagacaggctcaaaactcctgttgaaaatgccttgagagatgcaaatctt
tccatcaaggacatagatgaagtaattctggttggtgggtcaactagaatccctgctgtc
caagaacttgtcaggaagatgactgggaaagatcctaatgttacagtaaatccagatgaa
gttgtggcactgggggctgcagttcaggctggtgttttatctggtgatgtgagtgatatt
gtgctcttggacgttacgccattatcgcttggcttggaaactttgggtggcgtaatgaca
aaaatcattccaaggaatacaactctgccaacttctaagtcggaggtgttctccactgca
gcagatggacaaacaagcgtcgagatcaatgtgttgcaaggggagcgcgaatttgtgaaa
gacaacaaatctttaggaagtttccgtttggatgggatccctcctgctccgcgtggtgta
ccccagatagaagtcaaattcgacatagatgcaaatggtatcctttctgtcacagctatt
gacaagggaactggaaagaagcaggatatcactataactggtgccagcacgttgcccaaa
gatgaggtcgatagaatggttaaagatgctgaaagatatgctaaggaggacaaggaaaag
agagaagccattgacaccaagaatcaagcagagtctgtcatgtatcagactgaaaagcaa
ttgaaagagctgggagacaaaatccctgctgctgtaaaagacaaagtggaaagtaaatta
aaggaactgaaagattctatttccggtggatcgactcaggccatcaaggacgcaatgaca
gaacttaatcaagaagtcatgcaaatggggcaatctttgtacagccagccaggagctgct
ggtgctgagcatgcgggtggtgctaccagcgattctggttcaactggtaaatcatccgat
ggagatggagaagttatcgatgccgacttcagcgaaagcaactga

DBGET integrated database retrieval system