KEGG   Sesamum indicum (sesame): 105176616Help
Entry
105176616         CDS       T04135                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK11
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
sind  Sesamum indicum (sesame)
Brite
KEGG Orthology (KO) [BR:sind00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sind01001]
    105176616
   01009 Protein phosphatases and associated proteins [BR:sind01009]
    105176616
Enzymes [BR:sind01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105176616
Protein kinases [BR:sind01001]
 Serine/threonine kinases: Other
  Wnk family
   105176616
Protein phosphatases and associated proteins [BR:sind01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105176616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 105176616
NCBI-ProteinID: XP_011097788
Position
LG14
AA seq 300 aa AA seqDB search
MPSMGSDMGDRDRELFVEVDPTGRYGRYSELLGSGAVKKVYRAFDQEEGIEVAWNQVKLR
NLSDDETMINRLYSEVRLLGSLKNKNIIALYSVWRDEERNTLNFITEVCTSGNLREYRKK
HRQVSMKALKKWSRQILKGLDYLHTNDPCVIHRDLNCSNIFINGNIGQVKIGDLGLAATV
GKNHSAHSVLGTPEFMAPELYDEDYTEMIDIYSFGMCLLEMVTLELPYSECDNVVKIYKK
VTSGVRPQAMNKVKDPEVKAFIEKCLAQPRARPSAADLLKDPFFDSILDDDDENGDNSIS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcatgggttctgacatgggagatcgtgatagggagctgtttgtggaagttgat
ccaactggtaggtatggccggtatagtgagcttctcgggtcgggggctgtaaagaaagtg
tatagggccttcgaccaagaagaaggaattgaggtggcatggaaccaagttaagttacgg
aacttaagcgacgatgaaaccatgatcaaccggttgtattcagaggttcggttgctgggg
agtttaaaaaacaagaatattatcgcattgtactcagtatggagggatgaggagaggaac
actctgaatttcattactgaggtttgtacatcagggaatttgagggaatacaggaagaag
cataggcaggtttcaatgaaggctttgaagaagtggtccaggcagattctcaagggcttg
gactatttgcacactaatgacccctgtgtgattcatagggatctcaattgtagcaatatt
ttcatcaatggcaatattggtcaggtgaagatcggtgatttgggattggcagcaacagtg
gggaaaaatcactcagcccattcggtgctcggaacaccagaattcatggcacctgagtta
tatgatgaggactacacggagatgattgacatatattcgttcggtatgtgcttgctggag
atggtgactctcgagttaccctacagtgaatgtgacaatgttgtcaagatatataaaaag
gtgacttctggggtgagacctcaagccatgaacaaggttaaggaccctgaggtgaaagca
ttcatcgagaagtgtcttgctcagccaagggctagaccatcagccgctgatctcctcaaa
gacccgttttttgacagtattcttgatgacgacgatgaaaatggtgataatagtataagc
taa

DBGET integrated database retrieval system